KEGG   Heterocephalus glaber (naked mole rat): 101719127
Entry
101719127         CDS       T02812                                 

Gene name
Nlrp4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101719127 (Nlrp4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hgl04054]
    101719127 (Nlrp4)
Membrane trafficking [BR:hgl04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101719127 (Nlrp4)
Pattern recognition receptors [BR:hgl04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101719127 (Nlrp4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 SRP54 AAA_16 AAA_25 VirE G-alpha
Other DBs
NCBI-GeneID: 101719127
NCBI-ProteinID: XP_004867221
UniProt: G5CAV3
LinkDB
Position
Un
AA seq 984 aa
MASPFFSDFGLMWYLEELKKKEFMKFKELLKQETPLLGLKQISWAEVKKASREELANLLL
RHYEEQQAWDVTFRVFQKLGRRDLCEKAMRESTGNAKIYQTHMREKFTDFLSRESIPTMH
EQLDMNITQEECKFLELLFEPEKQTRILCLLGAQGVGKTTFLAKMILAWSKGFVYQDRFS
YIFYFCCKELKQLPATSLAGLITRAWPGTSAPVSEIMAHPEKLLFMADSFEELGSDLAEP
EDELCSDWAEVQPPKLLLSSLLRKKMAPECCLLVTVNPRAGQDLEDRLEDPDIRELTGLK
EFDVKFYICHMFPDRRRALEAFNVILNNEQLLSMCRLPVLCWLVCTTLKQEMDKGIDVAL
TCQRPTALYSSFLLDLFTPEGADGPSWQGQAQLQSLCSLAVQGMWTNTMVFREKDLRRNG
IGSSDLSALLELRVLLPCWETEGLYKFLHSSVQEFCAALFYLLKSPGHHSHPAVRGTQDL
LLTFLEKSRAHWVFVGCFLFGLLHERECQKLDAFFGFQLSSEVKRQLYQCLQQLAKVADK
LQGQVSFLALFYALFEMQEEAFLNQVMDLMQDLAFSVFIETDLRVAGYCLKHCSNLRKLS
LSAQGVFKEEGREQSSVSSSELLCWHQVWSVLRTCSQLQMLQVKDGTLNESAMLSLCQQL
RQPNCLLENLFVNNVTFHCESWTLFEAFPHNPNLKYVNLSNTQLGRDDVKVLHGALSHPT
SSVEKLLLVNCNLSADDCKALAATLMESKKLDSLNLSCNNLKKGVRALCKALCHPNCTLK
FLALSFCTLREWCWDYLAEVLLISKSLSHLDLSINSLRDEGLKVLCDTLRYPVCALQILC
LMKCSITAEGCRDLASVLTSSRNLRSLQIGGNNIEDAGVKLLCQALAQPSCLLETLGVED
CGLTSACCEDLVTVLTTSKTLFMLNLLQNPLDHGGVALLCQGLRHPECALRVLGLNSAEF
GEETQALLTAEEERNPDLVILDTW
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggcgtcgcctttcttttctgactttggcctcatgtggtacctggaggagctcaagaag
aaggagttcatgaagttcaaggagctgctcaagcaggagactccactgcttggactcaag
cagatctcctgggctgaagtgaagaaagcatcaagggaagaacttgccaacctactgctc
aggcattacgaggagcagcaagcctgggatgtgaccttcagggtctttcagaagctgggc
aggagggacctctgtgagaaggccatgagagagagcactggaaatgcgaagatatatcag
actcacatgagggagaaattcaccgacttcttgtccagggagtccattcccacgatgcat
gaacagttggatatgaatatcacgcaggaagaatgcaaatttctggaactcctcttcgag
cccgagaagcagacccgcattctatgcttgctgggagcccaaggagttgggaaaacaact
ttcctggcgaagatgatcctggcctggtccaagggcttcgtctaccaggacagattttcc
tacatcttctacttctgctgcaaggaactgaagcagctgccagcgacgagcttggcggga
ctgatcaccagagcctggcccggcacctctgcccctgtgagtgagatcatggcccacccc
gagaagctcctgttcatggccgacagttttgaagaactgggctctgacctggcggagccg
gaggacgagctctgcagcgactgggcggaggtgcagccaccaaagctgctgctgagcagt
ttgctgaggaagaagatggccccggagtgctgcctgcttgtcaccgtcaaccccagggcc
gggcaggacctggaggacaggctggaggaccctgacattagggagctcacgggcttgaaa
gagttcgacgtaaagttctacatctgccatatgttcccggacaggcgcagagccttggag
gctttcaacgtcatcctgaacaacgagcagctcctctcgatgtgccggctccctgtgctc
tgctggctggtgtgcacgaccctgaagcaggagatggacaaaggcatagacgtggcgctc
acctgccagcgtcccaccgccctgtatagctccttcctcttggacctcttcacgcctgag
ggtgccgacggccccagctggcagggccaggcccagctgcagagcctgtgctccctggcc
gtccagggcatgtggaccaacaccatggttttccgggagaaggacctcaggaggaacggg
ataggcagctccgacctctctgccttgctggagctcagggtcctcctgccgtgctgggag
actgagggcttgtacaagttcctgcactcctcggtgcaggagttctgcgctgccctgttc
tacttgctcaagagccccggccaccactcgcacccagccgtgaggggcacgcaggacctc
ctgctgaccttcctcgagaaatccagggcccactgggtgtttgttgggtgcttcctgttt
ggcctgttgcatgaaagggagtgtcagaagctggatgccttttttggcttccagctgtcc
agtgaggtaaagcggcagctgtatcagtgcctgcagcaactggcaaaggtggctgacaag
ctccaggggcaggtcagcttcctggccttattctatgctctgttcgagatgcaggaggag
gccttcctgaaccaggtgatggacttgatgcaagatcttgccttctccgtcttcattgag
acagacctgagggttgccggctactgcttaaaacactgctctaacttgaggaaactcagc
ctttccgcccagggtgtctttaaggaagaaggcagggaacagagctctgtctcgagctct
gagctcctctgctggcaccaggtgtggtcagtgctcaggacctgcagccaactccagatg
ctgcaggtgaaggatggcaccctcaacgagtccgccatgctgagtctgtgtcaacagctg
aggcagcccaactgtctcctcgagaatctttttgtcaacaatgttaccttccactgtgag
agttggactctctttgaggcattccctcataacccaaatttgaaatacgtgaaccttagc
aacacccagctgggccgcgacgatgtgaaggtcctccacggcgcgctgagccacccaacg
agcagtgtggagaagctgctgctggtaaattgtaacctgtcagctgacgattgcaaggcc
ttggccgccaccctgatggagagtaagaagctggactccctgaacctctcctgcaacaac
ctgaagaagggggtgcgtgctctgtgcaaggcactgtgccaccccaactgcaccctgaag
ttcctggcgttaagcttctgcaccctcagggagtggtgctgggactacctcgctgaagtt
ctcctgatcagcaagagcctgagccacctggacctcagcataaacagcttgagggacgag
gggctgaaggtcctctgtgacactctgagatacccggtctgcgcgctgcagatactatgc
ctgatgaagtgctccatcacggcggagggctgcagagacctggcctcggtcctcaccagc
agccggaacctgagaagcctgcagattggggggaacaacatagaggacgcgggggtgaag
ctgctctgccaggctctggcacagcccagctgcctcttggagaccctgggggtggaggac
tgcggcctaaccagcgcctgctgcgaggacctggtcaccgtgctcaccaccagcaagacc
ctgtttatgctgaacctgcttcagaatcccctggaccacggtggggtggcactgctgtgc
cagggcctgaggcaccctgagtgtgccctgcgggtgctgggactgaatagtgctgaattt
ggtgaggaaacccaggcacttctgactgctgaggaagagagaaatcccgacctggtcatc
ctggacacatggtga

DBGET integrated database retrieval system