KEGG   Heterocephalus glaber (naked mole rat): 101720581
Entry
101720581         CDS       T02812                                 

Gene name
Il2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04060  Cytokine-cytokine receptor interaction
hgl04061  Viral protein interaction with cytokine and cytokine receptor
hgl04151  PI3K-Akt signaling pathway
hgl04625  C-type lectin receptor signaling pathway
hgl04630  Jak-STAT signaling pathway
hgl04658  Th1 and Th2 cell differentiation
hgl04659  Th17 cell differentiation
hgl04660  T cell receptor signaling pathway
hgl04672  Intestinal immune network for IgA production
hgl04940  Type I diabetes mellitus
hgl05135  Yersinia infection
hgl05142  Chagas disease (American trypanosomiasis)
hgl05162  Measles
hgl05166  Human T-cell leukemia virus 1 infection
hgl05200  Pathways in cancer
hgl05320  Autoimmune thyroid disease
hgl05321  Inflammatory bowel disease (IBD)
hgl05330  Allograft rejection
hgl05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101720581 (Il2)
   04151 PI3K-Akt signaling pathway
    101720581 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101720581 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101720581 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101720581 (Il2)
   04660 T cell receptor signaling pathway
    101720581 (Il2)
   04658 Th1 and Th2 cell differentiation
    101720581 (Il2)
   04659 Th17 cell differentiation
    101720581 (Il2)
   04672 Intestinal immune network for IgA production
    101720581 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101720581 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101720581 (Il2)
   05321 Inflammatory bowel disease (IBD)
    101720581 (Il2)
   05330 Allograft rejection
    101720581 (Il2)
   05332 Graft-versus-host disease
    101720581 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101720581 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101720581 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101720581 (Il2)
   05162 Measles
    101720581 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    101720581 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hgl04052]
    101720581 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:hgl00536]
    101720581 (Il2)
Cytokines and growth factors [BR:hgl04052]
 Cytokines
  Interleukins
   101720581 (Il2)
Glycosaminoglycan binding proteins [BR:hgl00536]
 Heparan sulfate / Haparin
  Cytokines
   101720581 (Il2)
SSDB
Motif
Pfam: IL2 IL15
Other DBs
NCBI-GeneID: 101720581
NCBI-ProteinID: XP_004854993
LinkDB
Position
Un
AA seq 152 aa
MYKMLLLSCIALTLALITSSAPTSSSTRETQEQLEQLLLDLQVILKGVTRNPKLSKMLKP
KLYFPNKPSELQHLQCLEEELKVLEQVLNLAEHKHFPLINTKDFISNINVTVWKLKGSKT
ALTCELNDEEANIVQFLKGWIAFCQKIISTMT
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtacaagatgctgctcttgtcttgcattgcactaactcttgcactcatcacaagcagt
gcaccaacttcaagctctacaagggaaacacaggaacaactggagcaattgctgctggat
ttacaggtgattttgaaaggagttactaggaatcccaaactctccaagatgctaaaacct
aaactctactttcccaataaaccctcagaattgcaacatcttcagtgcctagaagaagaa
ctcaaagtcctggagcaagtgctaaatctagctgaacacaaacactttcccttgataaat
accaaggatttcatcagtaatatcaacgtaacagtttggaaactaaagggatccaaaaca
gcactcacgtgtgaactgaatgatgaagaagcaaacattgtacaatttctgaaaggatgg
attgccttttgtcagaaaatcatctcaacaatgacttaa

DBGET integrated database retrieval system