KEGG   Heterocephalus glaber (naked mole rat): 101721841
Entry
101721841         CDS       T02812                                 

Gene name
Raf1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04068  FoxO signaling pathway
hgl04071  Sphingolipid signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04218  Cellular senescence
hgl04270  Vascular smooth muscle contraction
hgl04360  Axon guidance
hgl04370  VEGF signaling pathway
hgl04371  Apelin signaling pathway
hgl04510  Focal adhesion
hgl04540  Gap junction
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04613  Neutrophil extracellular trap formation
hgl04625  C-type lectin receptor signaling pathway
hgl04630  JAK-STAT signaling pathway
hgl04650  Natural killer cell mediated cytotoxicity
hgl04660  T cell receptor signaling pathway
hgl04662  B cell receptor signaling pathway
hgl04664  Fc epsilon RI signaling pathway
hgl04666  Fc gamma R-mediated phagocytosis
hgl04720  Long-term potentiation
hgl04722  Neurotrophin signaling pathway
hgl04726  Serotonergic synapse
hgl04730  Long-term depression
hgl04810  Regulation of actin cytoskeleton
hgl04910  Insulin signaling pathway
hgl04912  GnRH signaling pathway
hgl04914  Progesterone-mediated oocyte maturation
hgl04915  Estrogen signaling pathway
hgl04916  Melanogenesis
hgl04917  Prolactin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04921  Oxytocin signaling pathway
hgl04926  Relaxin signaling pathway
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl04929  GnRH secretion
hgl04935  Growth hormone synthesis, secretion and action
hgl05010  Alzheimer disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05034  Alcoholism
hgl05132  Salmonella infection
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05163  Human cytomegalovirus infection
hgl05164  Influenza A
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101721841 (Raf1)
   04012 ErbB signaling pathway
    101721841 (Raf1)
   04014 Ras signaling pathway
    101721841 (Raf1)
   04015 Rap1 signaling pathway
    101721841 (Raf1)
   04370 VEGF signaling pathway
    101721841 (Raf1)
   04371 Apelin signaling pathway
    101721841 (Raf1)
   04630 JAK-STAT signaling pathway
    101721841 (Raf1)
   04068 FoxO signaling pathway
    101721841 (Raf1)
   04072 Phospholipase D signaling pathway
    101721841 (Raf1)
   04071 Sphingolipid signaling pathway
    101721841 (Raf1)
   04024 cAMP signaling pathway
    101721841 (Raf1)
   04022 cGMP-PKG signaling pathway
    101721841 (Raf1)
   04151 PI3K-Akt signaling pathway
    101721841 (Raf1)
   04150 mTOR signaling pathway
    101721841 (Raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101721841 (Raf1)
  09143 Cell growth and death
   04210 Apoptosis
    101721841 (Raf1)
   04218 Cellular senescence
    101721841 (Raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101721841 (Raf1)
   04540 Gap junction
    101721841 (Raf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101721841 (Raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101721841 (Raf1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101721841 (Raf1)
   04625 C-type lectin receptor signaling pathway
    101721841 (Raf1)
   04650 Natural killer cell mediated cytotoxicity
    101721841 (Raf1)
   04660 T cell receptor signaling pathway
    101721841 (Raf1)
   04662 B cell receptor signaling pathway
    101721841 (Raf1)
   04664 Fc epsilon RI signaling pathway
    101721841 (Raf1)
   04666 Fc gamma R-mediated phagocytosis
    101721841 (Raf1)
   04062 Chemokine signaling pathway
    101721841 (Raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101721841 (Raf1)
   04929 GnRH secretion
    101721841 (Raf1)
   04912 GnRH signaling pathway
    101721841 (Raf1)
   04915 Estrogen signaling pathway
    101721841 (Raf1)
   04914 Progesterone-mediated oocyte maturation
    101721841 (Raf1)
   04917 Prolactin signaling pathway
    101721841 (Raf1)
   04921 Oxytocin signaling pathway
    101721841 (Raf1)
   04926 Relaxin signaling pathway
    101721841 (Raf1)
   04935 Growth hormone synthesis, secretion and action
    101721841 (Raf1)
   04919 Thyroid hormone signaling pathway
    101721841 (Raf1)
   04928 Parathyroid hormone synthesis, secretion and action
    101721841 (Raf1)
   04916 Melanogenesis
    101721841 (Raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101721841 (Raf1)
  09156 Nervous system
   04726 Serotonergic synapse
    101721841 (Raf1)
   04720 Long-term potentiation
    101721841 (Raf1)
   04730 Long-term depression
    101721841 (Raf1)
   04722 Neurotrophin signaling pathway
    101721841 (Raf1)
  09158 Development and regeneration
   04360 Axon guidance
    101721841 (Raf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101721841 (Raf1)
   05206 MicroRNAs in cancer
    101721841 (Raf1)
   05205 Proteoglycans in cancer
    101721841 (Raf1)
   05230 Central carbon metabolism in cancer
    101721841 (Raf1)
   05231 Choline metabolism in cancer
    101721841 (Raf1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101721841 (Raf1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101721841 (Raf1)
   05212 Pancreatic cancer
    101721841 (Raf1)
   05225 Hepatocellular carcinoma
    101721841 (Raf1)
   05226 Gastric cancer
    101721841 (Raf1)
   05214 Glioma
    101721841 (Raf1)
   05221 Acute myeloid leukemia
    101721841 (Raf1)
   05220 Chronic myeloid leukemia
    101721841 (Raf1)
   05218 Melanoma
    101721841 (Raf1)
   05211 Renal cell carcinoma
    101721841 (Raf1)
   05219 Bladder cancer
    101721841 (Raf1)
   05215 Prostate cancer
    101721841 (Raf1)
   05213 Endometrial cancer
    101721841 (Raf1)
   05224 Breast cancer
    101721841 (Raf1)
   05223 Non-small cell lung cancer
    101721841 (Raf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101721841 (Raf1)
   05022 Pathways of neurodegeneration - multiple diseases
    101721841 (Raf1)
  09165 Substance dependence
   05034 Alcoholism
    101721841 (Raf1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101721841 (Raf1)
   05152 Tuberculosis
    101721841 (Raf1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101721841 (Raf1)
   05161 Hepatitis B
    101721841 (Raf1)
   05160 Hepatitis C
    101721841 (Raf1)
   05164 Influenza A
    101721841 (Raf1)
   05163 Human cytomegalovirus infection
    101721841 (Raf1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101721841 (Raf1)
   05165 Human papillomavirus infection
    101721841 (Raf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101721841 (Raf1)
   01522 Endocrine resistance
    101721841 (Raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101721841 (Raf1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101721841 (Raf1)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101721841 (Raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 Kdo
Other DBs
NCBI-GeneID: 101721841
NCBI-ProteinID: XP_004870498
UniProt: G5BJW2
LinkDB
Position
Un
AA seq 668 aa
MEHIQGAWKTISNGFGLKDAVFDGSNCISPTIMQQFGYQRRASDDGKLTDSSKTSSTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPFTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRIPVSSQHRYSTPHAFTF
NSSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIENNSLNASPRAWSRGFCVRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGPGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLMDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggtgcttggaagacgattagcaacggttttggactcaaggacgct
gtgtttgacggctccaactgcatctccccgacgatcatgcagcagtttggctatcagcgc
cgggcctcagatgatggcaaactcacagactcctcgaagacaagcagcaccatccgagtc
ttcttgccgaacaagcagagaacggtggtcaatgtgcggaatgggatgagcttgcacgac
tgccttatgaaagcgctcaaagtgaggggcctgcagccggaatgctgtgcagtgttcaga
cttctccatgaacacaaaggtaaaaaagcacgtttagattggaatactgatgctgcctct
ttgattggagaagaacttcaagtagatttcctggatcatgttcccttcaccacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaagtttctgcta
aatgggtttcggtgtcagacttgtggctacaaatttcatgagcactgcagcaccaaagtc
cctaccatgtgtgtggactggagtaacatcagacagctcttgttgtttccaaattccact
attggtgacagtggggtcccagcactaccatctttgacaatgcgtcggatgcgagagtct
gtttcccggattcctgttagttcccagcacagatactccacaccccacgctttcactttc
aactcctccagcccctcctccgaaggctccctctcccagaggcagaggtccacgtccaca
cccaatgtccacatggtcagtacaacgctgcccgtggacagcaggatgattgagaataac
agcctgaatgcttctcccagggcgtggtccagaggattttgtgtgaggggaagagatgca
attcgaagtcacagcgaatcagcctccccatcagccctgtccagcagccccaacaacctg
agcccaacaggttggtcgcagcccaaaacccctgtgccggcacagagagaacgtgctcca
ggacctggcacccaggagaagaacaaaattaggcctcgaggacagagagattcgagttac
tactgggaaatagaagccagtgaagtgatgctgtccacccggattgggtcaggctccttt
ggaactgtctataagggcaagtggcatggagatgtggcagtaaagatcctgaaggtggta
gacccaaccccagagcagttccaggccttcaggaacgaggtggcggtgcttcgcaaaaca
aggcatgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggctattgtg
acacaatggtgtgagggcagcagcctctataaacacctgcatgtccaggagaccaagttc
cagatgttccagctgatggacatcgcccggcagacggctcagggcatggactacttacac
gcgaagaacatcatccaccgagacatgaaatccaacaatatatttctccacgaaggccta
acagtgaaaattggcgattttggtttggcaacagtgaagtcccgctggagtggctctcag
caggtggagcagcccactggctctgtcctgtggatggccccagaggtgattcgaatgcag
gacaacaacccattcagctttcagtctgacgtttactcctacggcatcgtgctgtatgag
ctgatgacgggggagctcccctactcccacatcaacaaccgtgaccagatcatcttcatg
gtgggccgaggttatgcctcgccagaccttagcaagctgtacaagaactgccccaaggcc
atgaagcggctggtggcagactgtgtgaagaaggtgaaggaggagcggcctctcttcccc
cagatcctatcttccatcgagctgctccagcactctctgcccaagatcaaccggagtgca
tctgagccgtccctgcaccgggcagcgcacactgaagacatcaatgcatgcacgctgacc
acatccccgcggctgcctgtcttctag

DBGET integrated database retrieval system