KEGG   Heterocephalus glaber (naked mole rat): 101721899
Entry
101721899         CDS       T02812                                 

Gene name
Stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04062  Chemokine signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04217  Necroptosis
hgl04550  Signaling pathways regulating pluripotency of stem cells
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl04917  Prolactin signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04931  Insulin resistance
hgl04933  AGE-RAGE signaling pathway in diabetic complications
hgl04935  Growth hormone synthesis, secretion and action
hgl05145  Toxoplasmosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05163  Human cytomegalovirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05169  Epstein-Barr virus infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05212  Pancreatic cancer
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hgl05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101721899 (Stat3)
   04066 HIF-1 signaling pathway
    101721899 (Stat3)
   04068 FoxO signaling pathway
    101721899 (Stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101721899 (Stat3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101721899 (Stat3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101721899 (Stat3)
   04062 Chemokine signaling pathway
    101721899 (Stat3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101721899 (Stat3)
   04917 Prolactin signaling pathway
    101721899 (Stat3)
   04935 Growth hormone synthesis, secretion and action
    101721899 (Stat3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101721899 (Stat3)
   05206 MicroRNAs in cancer
    101721899 (Stat3)
   05205 Proteoglycans in cancer
    101721899 (Stat3)
   05203 Viral carcinogenesis
    101721899 (Stat3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101721899 (Stat3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101721899 (Stat3)
   05221 Acute myeloid leukemia
    101721899 (Stat3)
   05223 Non-small cell lung cancer
    101721899 (Stat3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101721899 (Stat3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101721899 (Stat3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101721899 (Stat3)
  09172 Infectious disease: viral
   05162 Measles
    101721899 (Stat3)
   05161 Hepatitis B
    101721899 (Stat3)
   05160 Hepatitis C
    101721899 (Stat3)
   05163 Human cytomegalovirus infection
    101721899 (Stat3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101721899 (Stat3)
   05169 Epstein-Barr virus infection
    101721899 (Stat3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101721899 (Stat3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101721899 (Stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101721899 (Stat3)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    101721899 (Stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N DUF4795 AP1AR Baculo_PEP_C Fib_alpha
Other DBs
NCBI-GeneID: 101721899
NCBI-ProteinID: XP_004859396
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNSQAATRQKMQQLEQMLTALDQMRRSIVSELAGLLSAVEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEAETGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTPECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctggacacgcgctacctggagcagctgcaccag
ctgtacagcgacagcttccccatggagctgcggcagttcctggcgccctggattgagagc
caggactgggcgtacgcggccagcaaggagtcgcacgccacactggtgttccacaacctc
ctgggcgagatcgaccagcagtacagccgcttcctgcaggagtccaatgtcctctaccag
cacaacctgcgccgtatcaagcagttcctgcagagcaggtacctggagaagcccatggag
atcgcgcgcatcgtggcacggtgcctgtgggaggagtctcggctcctgcagacggcggcc
accgctgcccagcaagggggccaggccaaccacccgacggccgctgtggtgacggagaag
cagcagatgctggagcagcacctgcaggacgtgcggaagcgggtgcaggacttggagcag
aaaatgaaggtggtggagaacctgcaggatgacttcgatttcaactacaagaccctcaaa
agccagggagacatgcaggacctgaacgggaacagccaggctgccacgcggcagaagatg
cagcagctggagcagatgctgacggcgctggaccagatgcgcaggagcatcgtaagcgag
ctggcagggctgctgtcggctgtggaatacgtgcagaagaccctcacagacgaggagctg
gctgactggaagcggcggcagcagatcgcgtgcattgggggcccgcccaacatctgcttg
gaccgcctggagaactggatcacctccttggcggagtcgcagctgcagacgcgccagcag
attaagaagctggaggagctgcagcagaaggtctcctataagggtgaccccatcgtgcaa
caccggcccatgctggaggagaggatcgtggagctattcagaaacctgatgaaaagcgcc
ttcgtggtggagcggcagccctgcatgcccatgcaccccgaccggcccttggtcatcaag
acgggcgtccagttcaccaccaaagtcaggctgctggtcaagttcccggagttgaattat
cagcttaaaattaaagtgtgcatcgacaaggactcgggggacgtggcggcgcttcgtggg
tcccggaagttcaatatcctgggcaccaacacaaaggtgatgaacatggaggagtccaac
aatggcagcctctctgcggagttcaagcacctgactctccgggagcagagatgtgggaac
ggaggccgcgccaactgcgacgcctccctgattgtgactgaggagctgcacctgatcacc
ttcgagaccgaggtctaccaccagggcctcaagatcgacctcgagacgcactcgcttcct
gtcgtggtgatctccaacatctgccagatgcccaacgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagcccccgatcgggacg
tgggaccaggtggccgaggtgctgagctggcagttctcctccaccaccaagcgcggcctg
agcatcgagcagctgaccacgctggccgagaagctcctaggacccggtgtgaactactcg
ggctgtcagatcacgtgggcaaagttctgcaaggagaacatggcgggcaagggtttctcc
ttctgggtgtggctggacaacatcatcgacctggtgaagaagtacatcctggccctgtgg
aatgagggatacatcatgggcttcatcagcaaggagcgggagcgcgccatcctgagcacc
aagccgcccggcaccttcctgctgcgcttcagcgagagcagcaaggagggtggcgtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcggtggagccatac
accaagcagcagctgaacaacatgtcatttgccgagatcatcatgggctataagatcatg
gatgccaccaacatcctggtgtccccactggtctacctgtaccctgacatccccaaggag
gaggcctttgggaagtactgccggcccgagagccaggagcacccggaagctgaaacaggt
agtgccgccccctacctgaagaccaagttcatctgcgtgaccccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgagccctcagcaggagggcagttcgagtccctcacgtttgacatggag
ctgaccccggagtgcgctacctcgcccatgtga

DBGET integrated database retrieval system