KEGG   Heterocephalus glaber (naked mole rat): 101722009Help
Entry
101722009         CDS       T02812                                 

Gene name
Lig4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    101722009 (Lig4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hgl03400]
    101722009 (Lig4)
Enzymes [BR:hgl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101722009 (Lig4)
DNA repair and recombination proteins [BR:hgl03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     101722009 (Lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_IV BRCT BRCT_2 RNA_ligase mRNA_cap_enzyme APG17
Motif
Other DBs
NCBI-GeneID: 101722009
NCBI-ProteinID: XP_004858619
UniProt: G5B8M6
LinkDB All DBs
Position
Un
AA seq 911 aa AA seqDB search
MAASQTSQTVASHVPFADLCSTLERMQKSKGRAEKIRHFKEFLDSWRKFHAALHKNQKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGKDALKLLNYRTPTGTRG
DAGDFAVIAYFVLKPRCLQKGSLNIQQVNELLDSIASNNSARKKDLVKKSLLQLITQSSA
LEQKWLIRMIVKDLKLGFSEKTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISI
TLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYQYFSRNGYNYTE
QFGASPSEGSLTPFIYNAFKPDVQICILDGEMMAYNPNTQTFMQKGNKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGRETLRKRYEILNSIFTPVSGRMEVIQKAQAHTKKEVIDALNE
AIDKREEGIMIKHPLSIYKPDKRGEGWLKIKPEYVNGLMDELDILIVGGYWGKGSRGGMM
SHFLCAVAEKPPPGEKPAVFHTLCRVGSGYTMKELYDLGLKLAKHWKPFQKKAPPSSILC
GTEKPEVYIEPRNSVIVQIKAAEIVPSEMYKTSCTLRFPRIEKIRDDKEWHECMTLDELE
QLRGKASGKLASKHLYVGSDDEPKEKKRKAAPKMKKVIGILENLKAPNLSNISKVSNIFE
DVEFCVMSGTDSHSKLDLENRIAELGGYIVQNPGPDTYCVIAGLENIRVRNIVSSDKHDV
VRPAWLLECFKTKTCLPWHPRFMIHMCPSTRQHFAREYDRYGDSYFVDTDLNQLKEVFSG
IKNSNAQTPKEMAPVIADLEYRYSWDRSSLSMFRHHTVYLDLYTVINDLSTKIEGTRLAI
VALELRFHGAKVVSCLAEGVSHVIVGEDQSRVADFKAFRRSLKKKFKILRECWVTDSIDK
CELEEESQYWI
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcacaaacttcacaaactgttgcatctcatgttccctttgcagatttatgt
tcaactttagaacggatgcagaaaagtaaaggacgtgcagaaaaaattagacacttcaag
gaatttttagattcttggagaaaatttcatgctgctcttcataagaaccaaaaagatgtt
acagactctttttacccagcaatgagacttattcttcctcagctggaaagagagagaatg
gcttatggaatcaaagaaactatgcttgctaagctttatattgaattgctgaatttaccg
agagaagggaaagatgctcttaaactcctcaattacagaacacctactggaactcgtgga
gatgctggagactttgcagtgattgcatactttgtgttgaagccaagatgtttacagaaa
ggaagtttaaacatacagcaagtcaatgaacttctggactcaattgccagcaataattct
gccagaaaaaaagacctagtgaaaaagagtcttcttcaacttataactcagagttcagca
cttgaacaaaagtggcttatacggatgattgtaaaggacttaaagcttggtttcagtgag
aaaactatattttctgtttttcataatgatgctgctgagttgcataatgtcaccacagac
ctggagaaagtctgtaggcaactccatgacccctctgttggactcagtgacatttctatc
acattgttttctgcctttaaaccaatgctggctgccatcgcagatattgagcacatcgag
aaggacatgaaacaccagagtttctacatcgaaaccaagctcgatggtgaacgcatgcag
atgcacaaagatggagatgtgtatcagtacttttctcgaaatgggtacaactacaccgag
cagtttggtgcttctcccagtgaaggttctcttacccccttcatttataatgcattcaaa
ccggatgtgcagatctgtatcctggatggtgagatgatggcctacaaccccaacacacaa
acttttatgcaaaaggggaataagtttgacattaaaagaatggtagaagattctgacctg
cagacttgttattgtgtttttgatgtgctaatggttaataataaaaagctaggacgtgag
accctgagaaagaggtatgagattcttaatagtatttttacaccagtatcaggtagaatg
gaagtaatacagaaagcacaagctcatacaaagaaagaagtcattgatgcattgaatgaa
gcaattgataaaagagaagagggaatcatgataaaacatcctctgtccatttataagcca
gacaaaagaggtgagggatggctaaaaattaaaccagagtatgtcaatggactgatggat
gaattggacatcttaattgtggggggatattggggtaaaggttcccggggtgggatgatg
tctcattttttgtgtgctgtcgcagagaagccacctcctggtgagaaaccagctgtgttt
cataccctctgtcgtgttggctcaggatacactatgaaagaactgtacgatctaggtttg
aaattggccaaacattggaagccttttcagaaaaaagctccaccaagtagcattttgtgc
ggaacagagaagccagaagtgtacattgagcctcgtaattctgtcatcgtccagattaag
gcagcagagattgtccccagtgaaatgtataaaactagctgcacattgcgttttccaaga
atcgagaagataagagatgacaaagagtggcatgaatgcatgactctggatgagttggaa
caactgagggggaaggcatctgggaaactcgcctcgaagcatctctatgtgggcagtgat
gatgaaccaaaagaaaaaaagcggaaagctgccccaaagatgaagaaagtcattgggatt
cttgaaaacctgaaagcacctaacctttctaacataagcaaagtttcgaatatatttgag
gatgtggaattctgtgtcatgagtggaacagacagtcattcaaaacttgacctggagaac
agaattgcagagcttggaggttacatagtgcagaacccaggccctgacacgtactgtgtg
attgcaggcttggagaacatcagagtgaggaacattgtgtcttcggataaacacgatgtg
gtccgccccgcgtggctgctggagtgttttaagaccaagacctgcttgccatggcatcct
cgatttatgattcacatgtgtccctctacaaggcaacattttgcacgggaatatgatcgc
tatggtgacagctattttgttgacacagatttgaaccaactgaaagaagtgttctcaggg
attaaaaattctaatgcccagactcccaaagaaatggcccctgtgattgcggatctggaa
tatcgttattcctgggaccgctcctctctcagcatgtttcgacaccacactgtttatttg
gacttgtataccgttattaatgacttgagtaccaaaattgagggaacgagattagctatt
gtggctttggagcttcgatttcacggagcaaaagtagtttcttgtttagctgaaggtgtg
tctcatgtgattgttggggaagatcagagtcgggttgcagattttaaagcttttcgaaga
agtcttaagaaaaagtttaaaatcctacgagaatgttgggtaacggattcaatagataaa
tgtgaattagaggaggaaagtcagtattggatttaa

DBGET integrated database retrieval system