KEGG   Heterocephalus glaber (naked mole rat): 101722054Help
Entry
101722054         CDS       T02812                                 

Gene name
B3galt4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00604  Glycosphingolipid biosynthesis - ganglio series
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    101722054 (B3galt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hgl01003]
    101722054 (B3galt4)
Enzymes [BR:hgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     101722054 (B3galt4)
Glycosyltransferases [BR:hgl01003]
 Glycan extension
  Glycolipid
   101722054 (B3galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 101722054
NCBI-ProteinID: XP_004846879
LinkDB All DBs
Position
Un
AA seq 370 aa AA seqDB search
MPRSLFRRLLLAALLLLMLWVLFGPSGLGEELLSLSLASLLPAPASSGPPLPLPRLLIPN
PKACGGPGTPPFLLILVCTAPDNRNQRDAIRATWGGLRQARGRRVRTLFMLGEPPGSSPE
DLARESAAQGDIVQAAFQDTYRNLTLKTLVGLNWASTHCPKARYVLKTDDDVYVNVPELV
SELTRRGGPWQPQERGTEPQEETAIVREGRAVASRAVPLLYLGRVHWRVRPSRAPGGRHL
VSEAQWPPTWGPFPPYASGTGYVLSSSAVQLILRVAGRVPALPLEDVFVGVSARRGGLAP
THCVKLAGATHYPLDRCCYGRLLLTSHRLDPGQMRAAWELLHEESPGPFCSWLQGALGIL
RCRVIAWLHN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcagcctcttccggcgccttctcttggccgcgctgctgctgctgatgctctgg
gtcctcttcgggccctcgggcttgggggaggagctgctgagcctctcgctggcgtccctg
ctcccggcccccgcctcgtcggggccgcccctgcccctgccccgcctcctgatccccaac
cccaaggcctgcggaggtcccggcaccccgcccttcctgctgatcctggtgtgcacggcc
cccgacaaccggaaccagagggacgccatccgggccacgtggggcggcctgcgccaggcc
agggggcgcagggtgcggacgctcttcatgctgggagagccccccggcagctcccccgag
gacctggcccgggagtcggcggcccagggggacatcgtgcaggccgccttccaggacacc
taccgcaacctcaccctcaagaccctcgtggggctgaactgggccagcacgcactgcccc
aaggcccgctatgtcctcaagacagacgacgatgtgtacgtcaacgtcccagagctggtg
tccgagctgacccgacgaggtggcccttggcagccacaggagaggggcacagagccccag
gaagagactgcgattgtcagggagggccgcgccgtggcgagcagggcagtgccacttctg
tacctaggccgggtacactggcgggtgaggccctctcgggccccaggaggccgccacctg
gtatcagaagcgcagtggcctccaacctggggccccttcccaccctacgcctcgggcacg
gggtacgtgctgtcctcctccgctgtgcagctcattctcagggtggcgggccgggtaccc
gcgctgccactggaggacgtgtttgtgggagtgagtgcgcggcggggcggcctcgcccct
acccactgtgtcaagctggctggcgccacccactaccccctggaccggtgctgctacggg
agactcctgctgacctcccacaggctggacccggggcagatgcgggcggcctgggagctg
ctgcacgaggaaagccccggccccttctgctcctggctccagggcgccctgggcatcctg
cggtgccgggtcatagcctggctgcataactga

DBGET integrated database retrieval system