KEGG   Heterocephalus glaber (naked mole rat): 101722101
Entry
101722101         CDS       T02812                                 

Gene name
Nr3c1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101722101 (Nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hgl03000]
    101722101 (Nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hgl03310]
    101722101 (Nr3c1)
Transcription factors [BR:hgl03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101722101 (Nr3c1)
Nuclear receptors [BR:hgl03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101722101 (Nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 101722101
NCBI-ProteinID: XP_004854384
UniProt: G5AQS2
LinkDB
Structure
PDB: 
5UC1

Position
Un
AA seq 774 aa
MDSKESLTPPSREEVPSSALGSERRNVIDFYKTLRGGATVKVSASSPSLAAASQSDSKQR
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETDTKVMGNDLGFPQQGQISLSSGETDF
QLLEESIANLSRSTSIPENSKSSASAVAGTPTEEFPKTESDISSEQQNLEGQTGTNGGNV
KSYPTDQSTFDILQDLEFSSGSPSKETNESPWRSDLLMDENCLLSPLGGEDDPFLLEGNS
NEDCKPLILPDTKPKIKDNGDVILSSPNSVPLPQVKTEKEDFIELCTPGVIKQEKLGPVY
CQASFSGANIIGNKMSAISIHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGS
ENWNRCQGSGDDNLSSLGTVNFPGRSVFSNGFSSPGMRPDVSSPPSSSSTTGPPPKLCLV
CSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRKCL
QAGMNLEARKTKKKIKGIQQATTGVSQDTSENPNKTIVPATLPQLTPTLVSLLEVIEPEV
LYAGYDGTVPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFL
MAFALGWRSYRQSSGNVLCFAPDLIINEQRMGLPYMYDQCKQMLFVSSELKRLQVSYEEY
LCMKTLLLFSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLD
SMHEIVGNLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggactccaaagaatcattaaccccacctagtagagaagaagtccccagcagtgcactt
ggttcagagaggcggaatgtgattgatttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttctccctcactggctgctgcttctcagtcagattccaagcagcga
agacttttggttgattttccaaaaggctcaggaagcaatgcacagcagccagatctgtca
aaagctgtttcactctcaatgggactgtatatgggagagacagacacaaaagtgatggga
aatgacctgggattcccacagcagggccaaatcagcctttcctctggagaaacagacttt
cagctcctggaagaaagtattgcaaacctcagtaggtcgactagtattccagaaaactcc
aagagttcagcatctgctgtggctggaacccccacagaggagtttcccaaaactgagtct
gatatatcttcagaacagcaaaacctagagggtcagactggcaccaatggtggcaatgtg
aagtcgtatcccacagaccaaagcacctttgacatcttgcaagatttggagttttcttct
gggtcaccaagtaaagagacgaatgagagtccttggagatctgacctgttgatggacgaa
aactgtttgctttctcctttgggaggagaggacgatccattccttttggaagggaactcg
aatgaagactgcaagcctcttattttaccggacactaaacctaaaattaaggataatgga
gatgtgatcttatcaagtcccaacagtgtaccactgccccaagtgaaaacagaaaaagaa
gacttcattgaactctgcacccctggggtaattaagcaggagaaactgggcccagtttat
tgtcaggcaagcttttctggggcaaatataataggtaataaaatgtctgccatttctata
catggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatccctt
tctcagcaacaggatcagaagcctatttttaatgtcattccaccaattcctgttggttca
gaaaattggaataggtgccaaggatctggagatgacaacctgagttccttggggactgtg
aacttccctggtcgatcagttttttctaacggcttttcaagccctggaatgaggccagat
gtaagctctcctccatctagttcctcaacaacaggaccacctcccaaactctgcctggtg
tgctctgatgaagcctcgggatgtcattatggggtcttgacatgtggaagctgtaaagta
ttcttcaaaagagcagtggaaggtagacagcacaattatctttgtgctggaagaaatgat
tgcatcattgataaaattcggagaaaaaactgcccagcctgtcgctatcgaaaatgtctt
caagctggaatgaacctggaagctcgaaaaacaaagaaaaaaattaaaggaattcagcaa
gccactacaggagtctcacaagacacttctgaaaatcctaacaaaacaatagttcctgca
acattaccacaactcacccctacgctggtgtcactcttggaagtcattgaacctgaggtg
ttatatgcaggatatgacggcactgttccagacacaacctggaggatcatgaccacactc
aacatgttaggtggacgccaagtgattgcagcagtgaaatgggcaaaggcaataccagga
ttcaggaacttacacctagacgaccaaatgacccttctgcagtactcatggatgtttctc
atggcatttgccctggggtggagatcatacagacaatcaagtggaaatgtgctgtgtttt
gctcctgatctgattattaatgagcagagaatgggtctaccctacatgtatgaccaatgt
aaacagatgctatttgtttcctctgagttaaaaaggcttcaggtatcttatgaagagtac
ctctgtatgaaaaccttacttcttttctcttcagttcctaaggaaggtttgaagagccaa
gagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagccattgtcaaa
agagaaggaaactccagccagaactggcagaggttttatcagctgacaaaacttttggac
tccatgcatgaaatagttggaaatctccttaactattgcttccaaacatttttggataag
actatgagtattgaattccctgagatgttagctgaaatcatcaccaatcaaataccaaaa
tattcaaatggaaatatcaaaaaacttctatttcatcaaaagtga

DBGET integrated database retrieval system