KEGG   Heterocephalus glaber (naked mole rat): 101722366Help
Entry
101722366         CDS       T02812                                 

Definition
(RefSeq) cytochrome P450 2E1
  KO
K07415  cytochrome P450 family 2 subfamily E polypeptide 1 [EC:1.14.13.-]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00140  Steroid hormone biosynthesis
hgl00590  Arachidonic acid metabolism
hgl00591  Linoleic acid metabolism
hgl00980  Metabolism of xenobiotics by cytochrome P450
hgl00982  Drug metabolism - cytochrome P450
hgl00983  Drug metabolism - other enzymes
hgl01100  Metabolic pathways
hgl04932  Non-alcoholic fatty liver disease (NAFLD)
hgl05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101722366
   00590 Arachidonic acid metabolism
    101722366
   00591 Linoleic acid metabolism
    101722366
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101722366
   00982 Drug metabolism - cytochrome P450
    101722366
   00983 Drug metabolism - other enzymes
    101722366
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101722366
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101722366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hgl00199]
    101722366
Enzymes [BR:hgl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     101722366
Cytochrome P450 [BR:hgl00199]
 Cytochrome P450, animal type
  CYP2 family
   101722366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 101722366
NCBI-ProteinID: XP_012925394
LinkDB All DBs
Position
Un
AA seq 494 aa AA seqDB search
MAVLGITLALLVWVVTLLLISIWKQIYSSWNLPPGPFPLPIIGNLLQVDIKDIPKSFTKL
AKRYGPVFTLHLGSRRIVVLHGYKAVKEVLLNHKNEFSGRGEIPVFQEYKDKGIIFNNGP
TWKDVRRFSLSILRDYGMGKQGNEARIQKEAGFLLQELRKTQGQPFNPTFLIGCAPCNVI
ADILFHSRFDYKDKTCLRLMRLFNEDFYLLSTPWLQFYNYFSDYLCYMPGSHRKVMKNLS
EIKAYALERAKEHLQSLDPNCPRDVTDCLLAEMEKENQSGELSMYTMENISVTLADLFFA
GTETTSTTLRYGLLILMKYPEVEEKLHEEIDRVIGPTRIPAVKDRLEMPYMDAVVHEIQR
FINLVPSNLPHEATRDTMFQGYLIPKGTVVIPTLDSVLYDDQEFPDPEKFKPEHFLNESG
KFKYSDYFKAFSAGKRVCVGEGLARMEVFLLLTAILQHFNLKSLVEPKDIDLKPITVGFG
NIPPHYKLCLIPRS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctgtacttggcatcactcttgccctgttggtgtgggtggtcaccctcctgcttata
tccatctggaagcagatctacagcagctggaacctaccccctggacctttcccacttccc
attattgggaatcttctccaggtggatatcaaggatattcccaaatccttcaccaagctg
gccaagcgctatgggcctgtattcacactgcacctgggctcacgacgtatagttgtccta
catggctacaaggcagtaaaggaggtgctgctgaaccacaagaatgaattctctggccga
ggtgaaatccccgtgttccaggaatacaaggacaaaggaattattttcaataatggaccc
acctggaaggatgtccggcggttctccctgagcatactccgagactacgggatgggaaaa
cagggcaatgaggcacggatccagaaggaagctgggtttttgctgcaggagctcaggaag
acccagggccagccttttaaccccacttttctcattggctgtgctccctgcaatgtcata
gctgacatcctcttccacagtcgttttgactataaggacaagacatgtctgaggctcatg
agattattcaatgaggacttctacctactcagtactccctggttgcagttttacaattat
ttttcagactacctatgctacatgcctggaagccacagaaaagtaatgaaaaatctgtct
gaaataaaagcttatgcattagaaagagctaaagaacaccttcagtcactggaccccaat
tgcccccgggatgtcactgactgcctgcttgcagaaatggagaaggaaaatcagagtggg
gagctttctatgtacacaatggaaaacatttctgtgactttggctgacttgttctttgcg
ggaacagagactaccagcaccactttgagatatgggcttctgattctcatgaagtaccca
gaagttgaagagaaacttcatgaagaaattgacagggtgattgggccaacacgcatacct
gctgtcaaagacaggttagaaatgccctacatggatgctgtagtacatgagattcagcga
ttcatcaacctagtgccctccaacctgccccatgaagcaacccgagacaccatgttccaa
ggatacctcatccctaagggcacagttgtcattccaactctggactccgttttgtatgat
gaccaagaattcccagatccagagaagttcaaaccagagcactttctaaatgaaagtggc
aagttcaagtacagtgactacttcaaggcattttctgcaggaaaacgggtgtgtgttgga
gaaggcctggcccgcatggaagtgtttctgcttttgactgccattctacagcattttaat
ctgaagtctcttgttgagccaaaggatatcgaccttaagcccatcacagttggctttggc
aacattccaccacactacaaactctgcctcattccccgatcataa

DBGET integrated database retrieval system