KEGG   Heterocephalus glaber (naked mole rat): 101723323Help
Entry
101723323         CDS       T02812                                 

Gene name
Tgm1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101723323 (Tgm1)
Enzymes [BR:hgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101723323 (Tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DUF5006
Motif
Other DBs
NCBI-GeneID: 101723323
NCBI-ProteinID: XP_004864150
LinkDB All DBs
Position
Un
AA seq 851 aa AA seqDB search
MDISGSYCLCHLPGAKPAVWTGGFVVTGASDQSPLPLLTGMMDSSRSDMGRWGGNPLQPP
ATPSPEPDRVWDRNRDRDRRRGGGARSFWARCCGCCSCRNREDDDWGPEPSGSRNRGSSS
WNRRPESRGSGVNAAGDGTVREGMLVVTRVDLLGSRSDQNRRDHHTDEFEYDELIVRRGQ
PFYLVLFLNRPYESSDRMALELLIGNNPEVGKGTHVIIPVDKGSSGGWKAHVTKASGQNL
NLRVHTSPSAIIGKFQFTVRTRCEAGEFQLPLDPRNEIYILFNPWCPEDIVYVDHEDWRQ
EYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVI
SAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTT
TVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKR
PDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYW
QRQEDGSFKIVYVEEKAIGTLIVTKAISSNMREDITHTYKHPEGSEAERKAVETAAAHGS
KPNVYASRDSTEDVAMQVEAQDAVMGQDLTVSVVLTNRGSNHRTVKLHLYLSVTYYTGVT
GSIFKESKKEVALAPGASDRMTMPVAYKEYQPHLVDQGAMLLNVSGHVKESGQVLAKQHT
FRVRTPDLSLTLLGAAVVGQECEVQIIFKNPLPITLTKVVFRLEGSGLQRPKVLNVGDIG
GNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPASGGGAFSEAGGDSRSG
ESIPMASRGGA
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggacatctctgggtcgtattgtctctgtcatctgcctggggccaaacctgctgtctgg
acgggcggttttgtggtgaccggagccagtgatcagtctcctttgcctcttcttacaggc
atgatggacagttctcgctcagacatgggccgctggggcgggaaccccttgcagccccct
gccacaccttctccagagccagaccgagtctgggaccgaaaccgagaccgagaccgacgc
cgaggaggaggagcccgttccttctgggctcgctgctgtggctgctgctcttgccggaat
agggaagatgacgactgggggcctgagccttctggctccagaaatcgagggtccagctct
tggaatcgaagacctgaatcccggggcagtggtgtgaatgcggcaggagatggcaccgtc
cgagagggcatgctggtggtgacccgtgtggatttgctgggctcccgctcagaccagaac
cgtcgagatcaccacaccgatgagtttgagtacgatgagctgattgtgcgccgtgggcaa
cctttctacctggtcctcttcctgaaccggccctatgagtcctctgaccgtatggccctt
gagctgctcattggaaacaaccctgaggtgggcaagggcacccacgtgatcatcccagtg
gacaaggggagcagtgggggctggaaggcccatgtgaccaaggccagcgggcagaatctg
aatctgcgggtccacacctcccccagtgccatcatcggcaagtttcagttcacggtccgc
acacgctgtgaggctggagagttccagctgcccttggacccccgcaatgagatctacatc
ctttttaacccctggtgcccagaggacatcgtgtatgtggatcatgaggactggcggcag
gaatatgtacttaatgagtctgggagaatttactatggaactgaagcacagattggtgag
cggacctggaactatggccagtttgaccacggggtgctggatgcctgcctgtatatccta
gaccggcgggggatgccatacggaggtcgtggggacccagtcagtgtctcccgcgtcatc
tctgctatggtgaactccctggatgacaatggagtcctgattgggaactggtctggcgat
tactccagaggcaccaacccttcagcgtgggtgggcagcgtggagatcctgcttagctac
ctacgcacaggctattctgtcccctatggccagtgttgggtctttgctggtgtgaccacc
acagtgttgcgatgcctgggcctagccacacgtactgtcaccaacttcaactctgcccac
gacactgacacatccctcactatggacatctactttgatgagaacatgaagccacttgag
catctgaaccacgattctgtttggaatttccatgtgtggaacgactgctggatgaagagg
ccggatctgccttcgggctttgatgggtggcaggttgtagacgccacaccccaggagact
agcagtggcatcttctgctgtggtccctgctctgtggagtccatcaagaatggcttagtc
tacatgaaatatgacacacccttcatttttgccgaggtgaatagtgacaaagtatactgg
cagcggcaggaagatggcagcttcaagattgtgtatgtagaggaaaaggctattggcacc
ctcattgtcacaaaagctatcagctccaacatgcgggaggacatcacccacacgtataag
catccagaaggctcagaagcagagcggaaggcagtggagacagcagctgcccatggcagc
aagcccaatgtgtatgccagccgagactctactgaggacgtggccatgcaggtggaagct
caggacgcagtgatgggccaggatctgacagtctctgtggtgctgacaaatcgtggcagt
aatcaccgcactgtgaagctgcacctctacctctctgtcacctactacactggtgtcact
gggtccatcttcaaagagagcaagaaggaagtggcactggcaccaggagcctcggaccgt
atgactatgcccgtggcctacaaggaataccagccccacctcgtggaccagggggccatg
cttctcaatgtctctggccatgtcaaggagagcgggcaggtgctggccaagcagcacacc
ttccgtgtgcgcaccccagacctctccctcacgttactgggagcagccgtggttggccag
gagtgcgaagtacagattatcttcaagaaccccctgcccattaccctgaccaaagttgtc
ttccggctcgagggctccgggttacagagacccaaagtcctcaatgttggggacatcggg
ggcaatgagacagtgaccctgcgccagacatttgtgcctgtgagaccaggcccacgccag
ctcattgccagcttggacagcccacagctctcccaggtgcacggtgtcatccaggtggat
gtggccccagcctctgggggcggggctttctcagaagctggaggtgacagtcgctctggg
gagtccatccctatggcatctcgaggtggagcttag

DBGET integrated database retrieval system