KEGG   Heterocephalus glaber (naked mole rat): 101723712
Entry
101723712         CDS       T02812                                 

Gene name
Tgfa
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04915  Estrogen signaling pathway
hgl05200  Pathways in cancer
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05223  Non-small cell lung cancer
hgl05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101723712 (Tgfa)
   04012 ErbB signaling pathway
    101723712 (Tgfa)
   04014 Ras signaling pathway
    101723712 (Tgfa)
   04151 PI3K-Akt signaling pathway
    101723712 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101723712 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101723712 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101723712 (Tgfa)
   05212 Pancreatic cancer
    101723712 (Tgfa)
   05225 Hepatocellular carcinoma
    101723712 (Tgfa)
   05214 Glioma
    101723712 (Tgfa)
   05211 Renal cell carcinoma
    101723712 (Tgfa)
   05215 Prostate cancer
    101723712 (Tgfa)
   05223 Non-small cell lung cancer
    101723712 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101723712 (Tgfa)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 101723712
NCBI-ProteinID: XP_012929457
LinkDB
Position
Un
AA seq 284 aa
MPGAEETCSGPMWVKPMKGSNEEPVVCEDSQESSFTFMMKAVWYENIKLAGYCADALTIA
SLRCGVSARRSALGARSCLPPPARAGGRPCLASAFFPRTGAPLRHSGGHLREGRRLERLL
PARKMVTSAGQLALLALGIVLAVCQALENSTSPLSAEPPVAAAVVSHFNDCPDSHTQFCF
HGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLII
TCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTSCCHSETVV
NT seq 855 nt   +upstreamnt  +downstreamnt
atgcctggagcagaagagacgtgcagtggccccatgtgggttaaaccaatgaaaggaagc
aatgaagagccagttgtctgtgaagactcccaagagagcagtttcaccttcatgatgaaa
gctgtgtggtatgaaaacataaagctggctgggtactgtgcagatgccctcaccattgcc
tccttgcgctgcggggtgagtgccaggcgctcggcgctcggcgctcggtcctgcctccct
ccgcccgcccgcgccgggggccggccctgcctcgccagcgcctttttcccccgcaccggg
gcgccgcttcgccactcgggcgggcacctcagggagggcagaaggctggagcgcctgctg
cccgcccgtaagatggtcacctccgctggacagctcgccctgctcgcgctgggtattgtg
ttggctgtgtgccaagccctggaaaacagcacatcgcccctgagcgcagaaccacccgtg
gccgcggcagtggtatcacattttaacgactgtccagattcccatactcagttctgcttc
catggaacctgcaggtttttggtgcaggaggacaagccagcatgtgtctgccattctggg
tacgtcggtgcacgatgtgagcacgcagatctcctggcagtggtggccgccagtcagaag
aagcaggccatcactgccttggtggtggtctccattgtggccctggctgtcctcatcatc
acttgtgtgctgatacactgctgccaggtccgaaagcactgtgagtggtgccgtgctctc
gtctgcaggcatgagaagcccagcgccctcctgaagggaagaacctcctgctgccactca
gaaacagtggtctga

DBGET integrated database retrieval system