KEGG   Heterocephalus glaber (naked mole rat): 101723771
Entry
101723771         CDS       T02812                                 

Gene name
Egfr
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04010  MAPK signaling pathway
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04015  Rap1 signaling pathway
hgl04020  Calcium signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04068  FoxO signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04144  Endocytosis
hgl04151  PI3K-Akt signaling pathway
hgl04510  Focal adhesion
hgl04520  Adherens junction
hgl04540  Gap junction
hgl04630  JAK-STAT signaling pathway
hgl04810  Regulation of actin cytoskeleton
hgl04912  GnRH signaling pathway
hgl04915  Estrogen signaling pathway
hgl04921  Oxytocin signaling pathway
hgl04926  Relaxin signaling pathway
hgl04928  Parathyroid hormone synthesis, secretion and action
hgl04934  Cushing syndrome
hgl05160  Hepatitis C
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05171  Coronavirus disease - COVID-19
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05219  Bladder cancer
hgl05223  Non-small cell lung cancer
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101723771 (Egfr)
   04012 ErbB signaling pathway
    101723771 (Egfr)
   04014 Ras signaling pathway
    101723771 (Egfr)
   04015 Rap1 signaling pathway
    101723771 (Egfr)
   04630 JAK-STAT signaling pathway
    101723771 (Egfr)
   04066 HIF-1 signaling pathway
    101723771 (Egfr)
   04068 FoxO signaling pathway
    101723771 (Egfr)
   04020 Calcium signaling pathway
    101723771 (Egfr)
   04072 Phospholipase D signaling pathway
    101723771 (Egfr)
   04151 PI3K-Akt signaling pathway
    101723771 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101723771 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101723771 (Egfr)
   04520 Adherens junction
    101723771 (Egfr)
   04540 Gap junction
    101723771 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101723771 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101723771 (Egfr)
   04915 Estrogen signaling pathway
    101723771 (Egfr)
   04921 Oxytocin signaling pathway
    101723771 (Egfr)
   04926 Relaxin signaling pathway
    101723771 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    101723771 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101723771 (Egfr)
   05206 MicroRNAs in cancer
    101723771 (Egfr)
   05205 Proteoglycans in cancer
    101723771 (Egfr)
   05230 Central carbon metabolism in cancer
    101723771 (Egfr)
   05231 Choline metabolism in cancer
    101723771 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101723771 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101723771 (Egfr)
   05212 Pancreatic cancer
    101723771 (Egfr)
   05225 Hepatocellular carcinoma
    101723771 (Egfr)
   05226 Gastric cancer
    101723771 (Egfr)
   05214 Glioma
    101723771 (Egfr)
   05218 Melanoma
    101723771 (Egfr)
   05219 Bladder cancer
    101723771 (Egfr)
   05215 Prostate cancer
    101723771 (Egfr)
   05213 Endometrial cancer
    101723771 (Egfr)
   05224 Breast cancer
    101723771 (Egfr)
   05223 Non-small cell lung cancer
    101723771 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101723771 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101723771 (Egfr)
   05171 Coronavirus disease - COVID-19
    101723771 (Egfr)
   05163 Human cytomegalovirus infection
    101723771 (Egfr)
   05165 Human papillomavirus infection
    101723771 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101723771 (Egfr)
   01522 Endocrine resistance
    101723771 (Egfr)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101723771 (Egfr)
Protein kinases [BR:hgl01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101723771 (Egfr)
Exosome [BR:hgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101723771 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   101723771 (Egfr)
  Exosomal proteins of bladder cancer cells
   101723771 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 101723771
NCBI-ProteinID: XP_004839898
LinkDB
Position
Un
AA seq 1211 aa
MRPCGVAGPALCALLALVGASAAPEEKRVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVV
LGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTAERIPLENLQIVRGNVLYENTYALAV
LSNYGGTNSANRTGLRELPLRSLQEILQGTVRFSNNPVLCSVDTIQWRDIMDSRFLSNMS
LDLQSHQSSCQKCDPSCPNGSCWAPGEENCQKLTRIICAQQCSGRCRGKSPSDCCHNQCA
AGCTGPRESDCLVCQKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPR
NYVVTDHGSCVRACGPDSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIK
HFRNCTAISGDLHILPVAFRGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPENRTDL
HAFENLEIIRGRTKQHGQFSLAVVGLNLTSLGLRSLKEISDGDVIVSGNRHLCYANTINW
RKLFGTSGQKTKIINNRGEKACTTDGHICHPLCSAEGCWGPQPWDCVSCRNVSRGRECVA
TCNVLEGEPREFVENSECIQCHPECLPQAMNVTCTGRGPDSCIQCAHYIDGPHCVKTCPA
GIMGENNTLVWKYADSSHVCRLCHPNCTYGCAGPGLEGCPIKGPRIPSIATGIVGGLFLL
VVLALGVGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKAKV
LGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRL
LGICLTSTVQLVTQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRD
LAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDV
WSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADS
RPKFRELIVEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYL
IPQQGFFSSPSTSRTPLLSSLSANSNNSTGACVHRNGQSCPAQGDNFLQRYSSDPTGAPA
EDSLDAEFLPAPEYINQSFSRRPAGSMQNPMYHNQPEHPAPGRDPHYLNPHSYAVGNPEY
LNTLLRTCVSDSDGSIPWTQKGNHQISLDNPDYQQDFFPKEAKPNGIFKGPTAENAEYLR
VAPPSSEFIGA
NT seq 3636 nt   +upstreamnt  +downstreamnt
atgcggccgtgcggggtggcggggccggcgctgtgcgcgttgctggcgctggtcggggcg
agtgcggcgcccgaagagaagcgcgtttgccaaggcacaagtaacaagctcacccagctg
ggcacctttgaggaccactttctgagcctccagcgcatgttcaacaactgtgaggtggtg
ctcgggaacctggagatcacctatgtgcaaaggaattacgacctttccttcctgaagacc
atccaggaggtggctggctatgtgctcattgctctcaacacggcagagaggatcccgctg
gagaacctgcagattgtgcgtgggaatgtgctctacgaaaacacctacgcccttgccgtc
ctgtctaattatgggggcaccaacagtgccaaccggaccgggcttcgggagctgccactg
aggagcctgcaggagatcctgcagggcaccgtgcgctttagcaacaaccccgtgctctgc
agcgtggacaccatccagtggagggacatcatggatagcagattcctgagcaacatgtca
ctggacctgcagagccaccagagcagctgccaaaagtgtgatccaagctgtcccaacggg
agctgctgggccccaggagaggaaaactgccagaaattgaccaggatcatctgtgcccag
cagtgctcggggcgctgccgaggcaagtcccccagcgactgctgccataaccagtgtgcg
gccggctgcacaggaccccgggagagtgactgcctggtctgccaaaagttccgcgacgaa
gccacctgcaaggacacctgcccgccgctcatgctctacaaccccaccacgtaccagatg
gatgtcaaccccgaggggaagtacagctttggcgccacctgcgtgaagaagtgtccccgg
aactacgtggtgacagaccatggctcctgtgtccgggcctgcggccccgacagctacgag
atggaggaggacggcgtccggaagtgcaagaagtgcgaaggcccctgccgcaaagtttgc
aacggaatagggatcggggaattcaaagacacgctttccataaatgccacaaacatcaag
cacttccggaactgcacagccataagcggcgacctgcacatcctcccggtggccttccgg
ggggactccttcacgcgcacgccgcccctggaccccaaggagctggacatcctgaagaca
gtgaaggagatcacagggttcttgctgattcaggcctggcctgagaacaggaccgacctc
cacgcctttgagaacctggaaatcatccgcggcaggacaaagcaacatggccagttttct
ctcgctgtcgttggcctgaacctgacgtccctggggctgcgctccctgaaggagatcagt
gatggggacgtgattgtctctggaaaccgacacctatgctatgccaacaccatcaactgg
agaaagctgtttgggacttccggtcagaaaaccaagattatcaacaacagaggcgagaag
gcctgcaccactgatggccacatctgccacccgctgtgctcagctgagggctgctggggt
ccccagccctgggactgcgtctcctgccggaacgtgagccggggcagagagtgcgtggcc
acgtgcaacgtcctggagggggagccccgggagttcgtggagaattctgagtgcatccag
tgccaccccgagtgcctgccccaggccatgaacgtgacctgcaccggcaggggccctgac
agctgcatccagtgtgcacactacatcgatggcccccactgtgtcaagacctgcccagcc
gggatcatgggggagaacaacacgctggtgtggaagtacgcggacagcagccacgtgtgc
cgcctgtgccaccccaactgcacctacggatgtgccgggccaggtctggaaggctgtcca
ataaaagggcccaggatcccctccatcgccactgggattgtgggcggcctcttcctgctg
gtggtgctggccctgggcgtcggcctcttcatgcggaggcgccacattgtccgcaagcgc
acactgcgccggctgctgcaggagcgtgagctggtggagcccctcacacccagtggagag
gcccccaaccaggccctgctgcggatcctaaaggagacagaattcaagaaggccaaggtg
ctaggctccggagcatttggcaccgtctacaagggactgtggatcccagaaggcgagaaa
gtgaagatccctgtggccatcaaggaattgcgagaagccacatccccgaaagccaacaag
gagatcctggacgaagcctatgtgatggccagcgtggacaacccccacgtgtgccgactg
ctgggcatctgcctaacctccaccgtgcagctggtcacacagctcatgcccttcggctgc
ctgctggactacgtgcgtgagcacaaggacaacatcgggtctcagcacctcctcaactgg
tgtgtgcagatcgccaagggcatgaactacctggaggaccggcgcctggtgcaccgggac
ctggcggccaggaacgtcctggtgaagacaccacagcatgtgaagatcacagacttcggg
ctggccaagctgctgggcgcggaggagaaggagtaccacgctgagggcggcaaggtgccc
atcaagtggatggctttggaatcgattttacaccgcatttatacccaccagagtgacgtc
tggagctatggagtcacagtgtgggagctgatgacctttgggtccaagccatatgacggg
atccctgcaagcgagatctcgtccatcctggagaaaggagagcgcctcccgcagccgccc
atctgcaccatcgacgtctacatgatcatggtcaagtgctggatgatagatgcagacagt
cgcccgaagttccgcgagttaatcgttgagttctccaaaatggcccgagacccccagcgc
taccttgtcattcagggggatgaaaggatgcatctgccaagccctacggactccaacttc
taccgtgccctgatggacgaggaggacatggaggatgtcgtagatgcagacgaatacctc
attccacagcagggcttcttcagcagcccctccacctcccggactccactcctgagttct
ctgagtgcaaacagcaacaactccacgggagcttgtgttcacagaaacgggcagagctgc
cctgcccagggagacaacttcctgcagcgctacagctcggaccccacgggcgccccagcc
gaggatagcctggatgccgagttcctcccagcacccgaatacataaaccagtccttctcc
agaaggcctgcaggctccatgcagaaccccatgtatcacaatcagcccgagcaccccgct
cctggcagagacccacactacctaaacccccacagctatgccgtgggcaaccctgagtat
ctcaacaccctcctgcggacctgtgtcagcgactcagacggctccatcccctggacccag
aagggcaaccaccaaattagcctggacaaccctgactaccagcaggacttcttccccaag
gaagccaagcccaacggcatctttaagggccccacagcggaaaatgcagaataccttcgg
gtggccccgccaagcagtgagtttattggagcgtga

DBGET integrated database retrieval system