KEGG   Heterocephalus glaber (naked mole rat): 101723887Help
Entry
101723887         CDS       T02812                                 

Gene name
Ggct
Definition
(RefSeq) gamma-glutamylcyclotransferase
  KO
K00682  gamma-glutamylcyclotransferase [EC:4.3.2.9]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00480  Glutathione metabolism
hgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101723887 (Ggct)
Enzymes [BR:hgl01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.9  gamma-glutamylcyclotransferase
     101723887 (Ggct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIG2_2 GGACT ChaC
Motif
Other DBs
NCBI-GeneID: 101723887
NCBI-ProteinID: XP_004839532
UniProt: A0A0P6K934
LinkDB All DBs
Position
Un
AA seq 190 aa AA seqDB search
MANSDFEGHAGQDGENFLYFAYGSNLLTERIHHRNSSAAFCCVACLQDFKLDFGNFQGKT
SQRWHGGIATIFQSPGDEVWGVVWKMHKSNLSSLDDQEGVESGTYVVIEVKVSTQEGKQL
TCRSYLMTNYESAPPSPQYKKVICLGAKENDLPLEYQEKLKAIEPNDYKGKVSEEMEEIL
NKEEQKLCRT
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattcggacttcgagggtcatgcaggccaggacggagagaatttcctgtacttc
gcgtacggcagcaacctgctgacggagaggatccaccaccgaaactcctcggccgcgttc
tgctgcgtggcctgcctgcaggattttaagcttgactttggcaatttccaaggcaaaaca
agtcaaaggtggcatggaggtatagctaccatttttcaaagtcctggcgatgaagtatgg
ggagtagtatggaaaatgcacaaaagcaatttaagttctctggatgaccaagaaggagtt
gaaagtggaacatatgtcgtaatagaagttaaagtttcaacgcaagaagggaaacaatta
acttgtcgaagttatctgatgacaaattatgagagtgctcccccgtcaccacaatataaa
aaagttatttgcctgggtgcaaaagaaaatgatttgccactggagtatcaagagaagtta
aaagcaatagaaccaaatgactataaaggaaaggtctcagaagaaatggaagaaattctc
aacaaggaagaacaaaaactctgtagaacataa

DBGET integrated database retrieval system