KEGG   Heterocephalus glaber (naked mole rat): 101724340
Entry
101724340         CDS       T02812                                 

Gene name
Mcl1
Definition
(RefSeq) BCL2 family apoptosis regulator
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04630  JAK-STAT signaling pathway
hgl05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101724340 (Mcl1)
   04151 PI3K-Akt signaling pathway
    101724340 (Mcl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101724340 (Mcl1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101724340 (Mcl1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 101724340
NCBI-ProteinID: XP_004854039
LinkDB
Position
Un
AA seq 344 aa
MFGLKRNAVIGLNLYCGGAGLGAGSGGATSPGGRLLATEKEAAARREAGGGEAGGSPAAA
PTQDARRGARPAPIGAELPDVSATPGRRLFFAPTLCARRPQDMAAPAAGAIMSPEEELDG
YEPEPLGKRPAVLPLLELVGEAGKSPSADGSLPSTPPPAEEEEDELYRQSLEIISRYLRE
QATGAKDSKPLGGPGAGAGSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL
SRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKNINQESCIEPLAESITEVLVQTKRDWL
IKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtttggtcttaaaagaaacgcggtaatcggcctgaacctctactgcggcggagccggg
ctgggcgccggcagcggcggcgccacctccccgggagggcggcttctggcgaccgagaag
gaggccgcggcccggcgggaggcggggggaggggaggcgggcgggagtcccgcggccgcc
ccgacgcaggacgcccggaggggcgcgcggccggcgcccattggcgccgagctccccgac
gtcagcgcgacccccggcaggcggctgttcttcgcgcccaccctctgcgccaggcggcct
caggacatggcagccccggccgctggcgccatcatgtcgcccgaggaggagctggacggc
tacgagccggagcctctcgggaagcggccggccgtgctgcccctgctggagctggtcggg
gaggccgggaagagccccagcgccgacggctcgctgccctcgacgccgcctccggcggag
gaggaggaggacgagctgtaccggcagtcgctggagatcatctcgcggtacctgcgggaa
caggccaccggcgccaaggactcgaagccgctgggcgggcccggggccggggcgggcagc
aggaaggcgctggagacgctgcggcgggtcggggacggtgtgcagcgcaaccacgagact
gccttccaaggaatgcttcgaaaactggacatcaaaaacgaagacgatgtcaaatccttg
tcacgagtgatggtccatgttttcagtgatggcgtaacaaactggggcaggattgtgact
ctcatttcttttggtgcctttgtggccaaacacttgaagaacataaaccaagaaagctgc
atcgaaccattagcagaaagtatcacagaagttctcgtacaaacaaaaagggactggcta
atcaaacaaagaggctgggatgggtttgtggagttcttccacgtagaggatctagaaggc
ggcatcagaaatgtgctgctggcttttgcaggtgttgctggagtaggagctggtttggca
tatctaataagatag

DBGET integrated database retrieval system