KEGG   Heterocephalus glaber (naked mole rat): 101725549
Entry
101725549         CDS       T02812                                 

Gene name
Ptpn2
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 2
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101725549 (Ptpn2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hgl01009]
    101725549 (Ptpn2)
Enzymes [BR:hgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101725549 (Ptpn2)
Protein phosphatases and associated proteins [BR:hgl01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101725549 (Ptpn2)
SSDB
Motif
Pfam: Y_phosphatase DSPc CHASE3 Y_phosphatase3
Other DBs
NCBI-GeneID: 101725549
NCBI-ProteinID: XP_004853333
UniProt: A0A0P6J607
LinkDB
Position
Un
AA seq 415 aa
MPATVQREFEELDAQCRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNIENDYINASLVHMEEAQRSYVLTQGPLPNTCCHFWLMVWQQKSKAVVMLNRVVEKES
VKCAQYWPTDDREMVFKETGFRVKLLSEDVKSYYTVHLLQLENISSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRASGSLDPEHGPAVVHCSAGIGRSGTFSLVDTCLLLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSNIQKRWKELSEEDLSPA
SDHSPTRGVTEKYNGNRICPEGEKLPGERCAGLSSKIQDSVEESRESVVRKRIREDRKAA
TAQKVQRMKQRLNETERKRKRWLYWQPILTKIGVLSVVLVGALVSWTLFFQQHVL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcccgccaccgtccagcgggagttcgaggagctggatgcacagtgtcgctggcagccg
ctatacctggaaattcggaatgagtcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaatcgaaacagatacagagatgtgagcccatatgaccacagccgtgttaaa
ctgcaaaatattgaaaatgattacattaatgccagcttagttcacatggaagaggcacaa
aggagttatgtcctaacacagggtccacttcctaatacctgctgccatttctggctcatg
gtctggcagcagaagtccaaagcagttgtcatgctaaaccgagttgtggagaaagaatcg
gttaaatgtgcacagtactggccaacagatgaccgagagatggtgttcaaagaaacagga
ttcagagtgaagctcttatcagaagacgtgaagtcatattatacagtacatctgctacag
ttagaaaatatcagtagtggtgaaaccagaacaatatctcactttcattatactacctgg
ccagattttggagtccccgaatcaccagcttcgtttctcaatttcttgtttaaagtgaga
gcgtctggctccttggaccctgagcatgggcctgcggtcgtgcactgcagcgccggcatt
gggcggtccggcaccttctccctagtggacacctgccttcttctgatggaaaaaggagat
gatattaacattaaacaagtattactaaatatgcgaaaatatcgaatgggacttattcag
actccagatcaactcagattctcttacatggccataatagaaggagcaaaatgtataaag
ggagattcaaatatacagaaacggtggaaagagctttctgaggaagacttatctcctgct
tcggatcattcaccgaccagaggcgtgactgagaagtacaatgggaacagaatctgtcct
gagggagagaagctgccgggggagcggtgtgcggggctgtcctccaagatacaggactct
gtggaggagagcagagagagtgttgtacggaaacgcattcgagaggacaggaaggccgcc
actgctcagaaggtgcagcggatgaaacagaggctaaatgagactgaacgaaaaagaaaa
aggtggttatattggcaacctattctcactaagatcggggttctgtcagtcgttttggtt
ggcgctttggttagctggacactgttctttcagcaacatgtcctgtaa

DBGET integrated database retrieval system