KEGG   Heterocephalus glaber (naked mole rat): 101725626
Entry
101725626         CDS       T02812                                 

Gene name
Mtor
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl04012  ErbB signaling pathway
hgl04066  HIF-1 signaling pathway
hgl04072  Phospholipase D signaling pathway
hgl04136  Autophagy - other
hgl04140  Autophagy - animal
hgl04150  mTOR signaling pathway
hgl04151  PI3K-Akt signaling pathway
hgl04152  AMPK signaling pathway
hgl04211  Longevity regulating pathway
hgl04213  Longevity regulating pathway - multiple species
hgl04218  Cellular senescence
hgl04371  Apelin signaling pathway
hgl04613  Neutrophil extracellular trap formation
hgl04630  JAK-STAT signaling pathway
hgl04659  Th17 cell differentiation
hgl04714  Thermogenesis
hgl04910  Insulin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl04920  Adipocytokine signaling pathway
hgl04930  Type II diabetes mellitus
hgl04931  Insulin resistance
hgl04935  Growth hormone synthesis, secretion and action
hgl05010  Alzheimer disease
hgl05014  Amyotrophic lateral sclerosis
hgl05016  Huntington disease
hgl05017  Spinocerebellar ataxia
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05163  Human cytomegalovirus infection
hgl05165  Human papillomavirus infection
hgl05167  Kaposi sarcoma-associated herpesvirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05205  Proteoglycans in cancer
hgl05206  MicroRNAs in cancer
hgl05210  Colorectal cancer
hgl05212  Pancreatic cancer
hgl05214  Glioma
hgl05215  Prostate cancer
hgl05221  Acute myeloid leukemia
hgl05224  Breast cancer
hgl05225  Hepatocellular carcinoma
hgl05226  Gastric cancer
hgl05230  Central carbon metabolism in cancer
hgl05231  Choline metabolism in cancer
hgl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101725626 (Mtor)
   04371 Apelin signaling pathway
    101725626 (Mtor)
   04630 JAK-STAT signaling pathway
    101725626 (Mtor)
   04066 HIF-1 signaling pathway
    101725626 (Mtor)
   04072 Phospholipase D signaling pathway
    101725626 (Mtor)
   04151 PI3K-Akt signaling pathway
    101725626 (Mtor)
   04152 AMPK signaling pathway
    101725626 (Mtor)
   04150 mTOR signaling pathway
    101725626 (Mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101725626 (Mtor)
   04136 Autophagy - other
    101725626 (Mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    101725626 (Mtor)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101725626 (Mtor)
   04659 Th17 cell differentiation
    101725626 (Mtor)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101725626 (Mtor)
   04920 Adipocytokine signaling pathway
    101725626 (Mtor)
   04935 Growth hormone synthesis, secretion and action
    101725626 (Mtor)
   04919 Thyroid hormone signaling pathway
    101725626 (Mtor)
  09149 Aging
   04211 Longevity regulating pathway
    101725626 (Mtor)
   04213 Longevity regulating pathway - multiple species
    101725626 (Mtor)
  09159 Environmental adaptation
   04714 Thermogenesis
    101725626 (Mtor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101725626 (Mtor)
   05206 MicroRNAs in cancer
    101725626 (Mtor)
   05205 Proteoglycans in cancer
    101725626 (Mtor)
   05230 Central carbon metabolism in cancer
    101725626 (Mtor)
   05231 Choline metabolism in cancer
    101725626 (Mtor)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101725626 (Mtor)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101725626 (Mtor)
   05212 Pancreatic cancer
    101725626 (Mtor)
   05225 Hepatocellular carcinoma
    101725626 (Mtor)
   05226 Gastric cancer
    101725626 (Mtor)
   05214 Glioma
    101725626 (Mtor)
   05221 Acute myeloid leukemia
    101725626 (Mtor)
   05215 Prostate cancer
    101725626 (Mtor)
   05224 Breast cancer
    101725626 (Mtor)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101725626 (Mtor)
   05014 Amyotrophic lateral sclerosis
    101725626 (Mtor)
   05016 Huntington disease
    101725626 (Mtor)
   05017 Spinocerebellar ataxia
    101725626 (Mtor)
   05022 Pathways of neurodegeneration - multiple diseases
    101725626 (Mtor)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101725626 (Mtor)
   04931 Insulin resistance
    101725626 (Mtor)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101725626 (Mtor)
   05168 Herpes simplex virus 1 infection
    101725626 (Mtor)
   05163 Human cytomegalovirus infection
    101725626 (Mtor)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101725626 (Mtor)
   05165 Human papillomavirus infection
    101725626 (Mtor)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101725626 (Mtor)
   01522 Endocrine resistance
    101725626 (Mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hgl01001]
    101725626 (Mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hgl04131]
    101725626 (Mtor)
Enzymes [BR:hgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101725626 (Mtor)
Protein kinases [BR:hgl01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101725626 (Mtor)
Membrane trafficking [BR:hgl04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    101725626 (Mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 101725626
NCBI-ProteinID: XP_004863641
UniProt: A0A0P6JH97
LinkDB
Position
Un
AA seq 2551 aa
MLGTGPAAATTAASTSSNVSVLQQFASGLKSRSEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKPTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLATLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRSVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMQRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELVLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTVQQQAQHAVATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTATASTEGSNSESEAESTEH
SPTPSPVQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPD
VNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTV
ASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLY
FGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLT
QAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAP
SLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRK
NLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHL
TLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGD
RHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRI
TCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEIL
DGVELGEPAHKKAGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDT
LDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7656 nt   +upstreamnt  +downstreamnt
atgctgggaacgggccctgccgctgccaccacagctgcctccacctctagcaacgtgagt
gtcctgcagcagttcgccagcggtctgaagagccggagtgaggagaccagggccaaagcg
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggagtct
actcgattctatgatcagctgaaccatcacatttttgaattggtttctagctcggatgcc
aacgagaggaaaggtggcatcttggccattgccagcctcataggagtggaaggtggaaat
gccacacggatcggcaggtttgccaactaccttcggaacctcctgccctccagtgaccca
gttgtcatggaaatggcctccaaggccatcggccgtcttgccatggcaggggacactttc
actgccgagtacgtggagtttgaggtgaagcgagccctggagtggctgggtgctgaccgc
aacgaaggccggagacatgcagctgtcctggtcctccgtgagctggccatcagtgtcccc
accttcttcttccagcaagtgcaacccttctttgacaacatttttgtggccgtatgggac
cccaagcaggccatccgtgagggagccgtggccgccctccgtgcctgtctgattctcacc
acccagcgagagccgaaggagatgcagaagccccagtggtatcggcacacatttgaagaa
gcagagaaagggtttgatgagaccttggccaaagagaagggcatgaatcgggacgatcgg
atccacggtgccttgctgatcctcaatgagctggtccggatcagcagcatggagggggag
cgtctgagagaagaaatggaagaaatcacacagcagcagctagtgcacgataagtactgc
aaagatctcatgggctttgggacgaaaccccgccacattacccccttcaccagtttccag
gccgtgcagccccagcagtccaacgccttggtggggctgctggggtatagttctcaccag
ggcctcatggggttcggggcttcccccagcccagccaagcccaccctggtggagagccgg
tgttgcagagacctgatggaggagaagtttgaccaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatctgttgccccgcttggct
gcattccgaccttctgcctttacagatacccagtaccttcaagataccatgaaccatgtc
ctgagctgtgtcaagaaggaaaaggaacgtacagcagccttccaagccctgggattactg
tctgtggctgtgaggtcagagtttaaggtctacctgcctcgtgtgctggacatcatccga
gcagccctgccccctaaggacttcgcacacaagaggcagaaagcaatgcaggtggatgcc
acagtgttcacatgcatcagcatgctggcccgagcaatggggccgggcatccagcaggac
atcaaggagctgctggagcccatgctggcagtgggactgagccccgccctcactgccgtg
ctctatgacctgagccgccagattccgcagctgaaaaaggacatccaggatgggctcctg
aagatgctatccctggtccttatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcccaccagctggcctcccctggcctcgccaccctccctgaggccagcgatgtgggc
agtatcactcttgccctccgaacccttggcagctttgaatttgaaggccactccctgacc
cagtttgtccgccactgtgcggatcatttcctgaacagcgagcacaaggagatccgcatg
gaagctgctcggacgtgctctcgcctgctcactccttccatccacctcatcagcggccat
gctcacgtggttagccagaccgcagtgcaagtggtggccgatgtgctcagcaaactgctc
gtggttgggatcaccgatcctgaccccgacatccgctactgtgtcttggcatccctggat
gagcgctttgatgcacacctggcccaggcagagaatttgcaggccctgtttgtggccctg
aacgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccgcctcagcagc
atgaacccggcattcgtcatgccgttcttgcgcaagatgctcatccagattttgacagag
ctggagcacagtggcattgggagaatcaaggagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccggctcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagacccagaccctgatccaaacccaggcgtgatcaataatgtcttggcc
acaataggagaattggctcaggttagtggccttgaaatgaggaagtgggtggatgaactt
ttcattatcatcatggacatgctccaggattcctctctgttggccaaaaggcaggtggct
ctgtggacgttggggcaactggtggccagcactggctatgtggtagagccctacaggaag
tacccaaccttgcttgaggtgctgctgaattttctgaagactgagcagaaccagggcaca
cggagagaggctatccgtgtgttagggctcttgggggctttggatccctacaagcacaaa
gtgaacattggcatgattgaccagtcccgggacgcttctgctgtcagcctgtctgaatcc
aagtcaagtcaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgcccctggatgaattctacccggctgtgtccatggtggccctgatgcggatcttccga
gaccagtccctctctcaccatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcctacattccttaatgtc
atccgggtctgtgacggggccatccgggaatttctgttccagcagctgggaatgttggta
tcctttgtgaagagccacattaggccttacatggatgaaatcgtcaccctcatgcgtgaa
ttctgggtcatgaacacctcgatccagagcacaatcattcttctcattgagcaaattgtg
gtagctcttgggggtgagtttaagctgtacctgccccagctgatcccacacatgctgcgg
gtcttcatgcacgacaacagcccgggccgcagtgtctctatcaagctgttggcggcaatc
cagctgtttggtgccaacctggacgactacctgcatttgttgttgcctccaatcgtgaag
ctgttcgacgcccctgaagtcccactcccatctcgaaaggcagcgttggagacagtggac
cgcttgactgagtccctggatttcacagactacgcctcccggatcattcacccaattgtt
cgaaccctggaccagagcccagagctgcgttccacagccatggacaccttgtcttcactt
gtctttcagctggggaagaagtaccaaattttcattccaatggtgaacaaagttctagtg
cgacaccgaatcaaccatcagcgctatgatgtgctcatctgcagaattgtcaagggatac
acccttgcagatgaagaggaggaccccttgatttaccagcaccggatgcagaggagtggc
caaggagatgcactggccagtgggccagtagaaacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagccgccagaagggtctccaaagatgattgg
ctggaatggctgagacggctgagcctggagctgctgaaggactcctcgtccccctccctg
cgctcgtgctgggcccttgcacaggcctacaacccaatggccagggatctcttcaatgct
gcatttgtgtcctgctggtcggaactgaatgaagaccagcaggatgagctcatcagaagc
atcgaattggccctcacctctcaagatattgctgaagtcacgcaaaccctgttaaacttg
gctgaattcatggaacacagtgacaaggggcccttgccattgagagatgacaatggcatt
gtcctgctgggtgagagagctgccaagtgccgagcatatgccaaagcactgcactacaaa
gaactggagttccagaaaggtcccacccccgccatcctcgagtccctcatcagcattaat
aataagctacagcagcccgaggctgccgccggggtgttagaatatgccatgaaacacttt
ggagagctggagatccaggccacgtggtatgagaaactgcacgagtgggaggatgctctt
gtagcctatgacaagaagatggacaccaacaaggatgacccggagctggtgctgggccgc
atgcgctgcctggaagccttgggggaatgggggcagctccaccagcagtgctgtgaaaag
tggacgctggtgaatgatgagacccaagccaagatggccaggatggctgccgcagctgcg
tggggcttgggtcagtgggacagcatggaagagtacacctgtatgatacctcgggacacc
cacgatggggcgttttacagagccgtgctggcgctgcatcaggacctcttctccttggca
cagcagtgcatcgacaaggccagggacctgctggatgctgagctaactgccatggcagga
gagagctacagtcgggcatatggggccatggtttcttgccatatgctctccgaactggag
gaggttatccagtacaaacttgtccctgagcgacgagagatcattcgccagatctggtgg
gagagactgcagggctgccagcggatcgtggaggactggcagaaaatcctgatggtgcgg
tcccttgtggtcaatcctcatgaggacatgaggacctggctcaagtacgcaagcctgtgt
ggcaagagcggcaggctggctcttgctcacaaaaccttagtgttgctcctgggtgttgat
ccatctcggcaacttgaccatcctctgcccacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagcgcgcgcaagatcgacgctttccagcacatgcagcacttt
gtccagacggtgcagcagcaggcccagcacgccgttgccactgaggaccagcagcacaag
caagagctgcacaagctcatggcccggtgtttcctgaaacttggggagtggcagctaaac
ctccagggcatcaatgagagcaccatccccaaagtgctgcagtactacagtgccgccaca
gagcatgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaattttgaagct
gtgctacactacaaacaccaaaatcaagcccgcgatgagaagaagaagctgcgtcatgct
agcggggccaacatcaccaatgccaccactgctgccaccactgctgccactgccaccacc
accgccaccgccagcacagagggcagcaacagtgagagtgaagctgagagcacggagcac
agccccactccgtcacctgtgcagaagaaggtcactgaggacttgtccaaaaccctcctg
atgtacactgtccctgccgtccagggcttcttccgttctatctccttgtctcgtggcaac
aacctccaggatacactcagagtccttaccttatggtttgattatggtcactggccggat
gtcaacgaagccttagtggaaggggtgaaagcaatccagatcgatacgtggttacaggtt
atacctcagctcattgcaagaatagatacacccaggcccttggtggggcggctcattcac
cagcttctcacagacattggtcggtaccacccccaggccctcatctaccccctgacggtg
gcttccaagtctaccacaacggcccgccacaacgcagccaacaagattctgaagaacatg
tgtgagcatagtaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgc
gtggccatcctctggcatgagatgtggcacgaaggcctggaagaggcgtctcgtttgtac
ttcggggagaggaatgtgaaaggcatgtttgaggtgctggagcctctgcatgcgatgatg
gaacggggcccccagaccctgaaggagacgtcctttaaccaggcatatggccgagatttg
atggaggcccaggagtggtgccggaagtacatgaaatcagggaatgtcaaggacctcacc
caagcctgggacctctactaccatgtgttcagacggatctcaaagcagctgccccagctc
acatccttagagctgcagtatgtttcccctaaacttctgatgtgccgggaccttgaattg
gctgtgccgggaacgtatgaccccaaccagccaatcattcgcattcagtccatcgcccca
tctttgcaagtcatcacatccaagcagaggccccggaagttgaccctcatgggcagcaat
gggcatgagtttgtcttcctcctgaaaggccatgaagacctgcggcaggatgagcgagtg
atgcagctcttcggcctggtcaacaccctcctggccaacgacccaacatccctccgcaaa
aacctcagcatccagagatatgccgtcatccctctgtcgaccaactcgggcctcattggc
tgggtgccccactgtgacacgctgcatgcactcatccgggactacagggagaagaagaag
atcctcctcaacattgagcaccgcatcatgctgcgaatggctccagactatgaccacctg
actctgatgcagaaggtggaggtgtttgagcatgctgtcaacaacacagcgggggacgac
ctggccaagctgctgtggctgaagagccccagctcggaggtgtggtttgaccgaagaacc
aattatacccgctcgttagcagtcatgtcgatggttggctatattttgggcctgggggat
aggcacccatccaacctgatgctggaccggctcagtgggaagatcctgcacatcgacttc
ggggactgctttgaggttgctatgacccgagagaagtttccagagaagattccatttaga
ctaacaagaatgttgaccaatgctatggaggtaacaggtctggatggaaactacagaatc
acctgccacacagtgatggaagtgcttcgggaacacaaggacagcgtcatggccgtgctg
gaagccttcgtctatgaccccttgctgaactggagactgatggacacaaataccaaaggc
aacaagaggtcccggacgaggacagattcctactctgcaggccagtcagtagaaattttg
gatggtgtggaacttggggaaccagcccataaaaaagcagggaccacggtgccagaatct
attcactcgttcattggagacggtttggtgaaaccagaagccctaaacaagaaggctatt
cagatcattaacagggtgcgagataagctcaccgggcgggacttctcccacgacgatacc
ctggatgttccaacgcaagttgagctgctcatcaaacaagcaacatcccatgagaacctc
tgccagtgctacattggctggtgtcccttctggtaa

DBGET integrated database retrieval system