KEGG   Heterocephalus glaber (naked mole rat): 101725846Help
Entry
101725846         CDS       T02812                                 

Gene name
Gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl00250  Alanine, aspartate and glutamate metabolism
hgl00410  beta-Alanine metabolism
hgl00430  Taurine and hypotaurine metabolism
hgl00650  Butanoate metabolism
hgl01100  Metabolic pathways
hgl04727  GABAergic synapse
hgl04940  Type I diabetes mellitus
Module
hgl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101725846 (Gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101725846 (Gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101725846 (Gad1)
   00430 Taurine and hypotaurine metabolism
    101725846 (Gad1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    101725846 (Gad1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101725846 (Gad1)
Enzymes [BR:hgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101725846 (Gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101725846
NCBI-ProteinID: XP_004857705
UniProt: A0A0P6JY11
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASPTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLISCENSDRDAHFQRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLTYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIVGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVVLIKCNERGKIIPADLEAKILEAKQKGCVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNRDEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSLERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctccgaccccttcttcgtctgcaacctcctcgaacgcgggagcggatcccaat
accactaacctgcgccccacaacctatgacacctggtgcggtgtggcccatggatgcacc
agaaaactggggctgaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agtcggcttgtgagtgccttcaaggagagacagtcctccaagaacctgatttcctgtgaa
aacagcgatcgggatgcccacttccagcgcacagagactgacttctccaacctgtttgcc
cgagatctgcttccagctaagaatggggaggagcaaaccgtgcagttcctactggaagtg
gtggacatactccttacctatgtccgcaagacatttgatcgctccaccaaggtgctggat
ttccaccacccacaccagttgctagaaggcatggagggctttaacttggagctctctgac
caccccgagtcactggagcagatcctggttgactgcagagacaccctgaagtatggagtg
cgcacaggtcaccctcgatttttcaaccagctttccactggcctggacatcgttggctta
gccggagaatggctgacgtcaactgccaataccaatatgtttacatatgaaattgcacca
gtatttgtcctcatggagcaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggctgtgccc
aaactggtcctcttcacctcagaacacagtcactattccataaagaaagctggggctgca
cttggatttggaactgacaatgtggttttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgaagccaagcaaaaaggatgtgttcctctttat
gtcaatgcaactgctggcacgactgtttatggagcttttgatccgatacaggagattgca
gatatatgtgagaaatataacctttggctacatgtcgatgccgcctggggcggtgggctg
ctcatgtccaggaagcaccgccataaactcagcggcatagaaagggccaactcagtcacc
tggaacccacacaagatgatgggcgtgctgctccagtgctcggccattctcgtcaaggag
aagggtatactccaaggatgcaaccagatgtgtgcagggtatctcttccagccagacaag
caatatgatgtctcctacgatactggggacaaggcaattcagtgtggccgccatgtggac
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgcctagaactggctgaatacctctatgccaagattaaaaacagagacgaattt
gagatggtttttgatggggagcctgagcacacaaatgtctgtttctggtacattccacaa
agcctcagaggtgttccggacagccttgagcgacgggaaaaactacacagggtggcccca
aagatcaaagccctaatgatggagtcaggcacaaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctcaaaccctgctgccacccagtctgacatc
gacttcctcattgaagagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system