KEGG   Heterocephalus glaber (naked mole rat): 101726042
Entry
101726042         CDS       T02812                                 

Gene name
Bad
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
hgl  Heterocephalus glaber (naked mole rat)
Pathway
hgl01521  EGFR tyrosine kinase inhibitor resistance
hgl01522  Endocrine resistance
hgl01524  Platinum drug resistance
hgl04012  ErbB signaling pathway
hgl04014  Ras signaling pathway
hgl04022  cGMP-PKG signaling pathway
hgl04024  cAMP signaling pathway
hgl04062  Chemokine signaling pathway
hgl04140  Autophagy - animal
hgl04151  PI3K-Akt signaling pathway
hgl04210  Apoptosis
hgl04370  VEGF signaling pathway
hgl04510  Focal adhesion
hgl04722  Neurotrophin signaling pathway
hgl04910  Insulin signaling pathway
hgl04919  Thyroid hormone signaling pathway
hgl05010  Alzheimer disease
hgl05014  Amyotrophic lateral sclerosis
hgl05020  Prion disease
hgl05022  Pathways of neurodegeneration - multiple diseases
hgl05145  Toxoplasmosis
hgl05152  Tuberculosis
hgl05160  Hepatitis C
hgl05161  Hepatitis B
hgl05162  Measles
hgl05165  Human papillomavirus infection
hgl05168  Herpes simplex virus 1 infection
hgl05170  Human immunodeficiency virus 1 infection
hgl05200  Pathways in cancer
hgl05203  Viral carcinogenesis
hgl05210  Colorectal cancer
hgl05211  Renal cell carcinoma
hgl05212  Pancreatic cancer
hgl05213  Endometrial cancer
hgl05215  Prostate cancer
hgl05218  Melanoma
hgl05220  Chronic myeloid leukemia
hgl05221  Acute myeloid leukemia
hgl05223  Non-small cell lung cancer
hgl05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hgl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101726042 (Bad)
   04014 Ras signaling pathway
    101726042 (Bad)
   04370 VEGF signaling pathway
    101726042 (Bad)
   04024 cAMP signaling pathway
    101726042 (Bad)
   04022 cGMP-PKG signaling pathway
    101726042 (Bad)
   04151 PI3K-Akt signaling pathway
    101726042 (Bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101726042 (Bad)
  09143 Cell growth and death
   04210 Apoptosis
    101726042 (Bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101726042 (Bad)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101726042 (Bad)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101726042 (Bad)
   04919 Thyroid hormone signaling pathway
    101726042 (Bad)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101726042 (Bad)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101726042 (Bad)
   05203 Viral carcinogenesis
    101726042 (Bad)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101726042 (Bad)
   05212 Pancreatic cancer
    101726042 (Bad)
   05225 Hepatocellular carcinoma
    101726042 (Bad)
   05221 Acute myeloid leukemia
    101726042 (Bad)
   05220 Chronic myeloid leukemia
    101726042 (Bad)
   05218 Melanoma
    101726042 (Bad)
   05211 Renal cell carcinoma
    101726042 (Bad)
   05215 Prostate cancer
    101726042 (Bad)
   05213 Endometrial cancer
    101726042 (Bad)
   05223 Non-small cell lung cancer
    101726042 (Bad)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101726042 (Bad)
   05014 Amyotrophic lateral sclerosis
    101726042 (Bad)
   05020 Prion disease
    101726042 (Bad)
   05022 Pathways of neurodegeneration - multiple diseases
    101726042 (Bad)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101726042 (Bad)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101726042 (Bad)
   05161 Hepatitis B
    101726042 (Bad)
   05160 Hepatitis C
    101726042 (Bad)
   05162 Measles
    101726042 (Bad)
   05168 Herpes simplex virus 1 infection
    101726042 (Bad)
   05165 Human papillomavirus infection
    101726042 (Bad)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101726042 (Bad)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101726042 (Bad)
   01524 Platinum drug resistance
    101726042 (Bad)
   01522 Endocrine resistance
    101726042 (Bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 101726042
NCBI-ProteinID: XP_004852572
UniProt: G5B6Q3
LinkDB
Position
Un
AA seq 162 aa
MFQIPEFEPSEQEDSSSEERALGPTPTGDRLGPSSPGGFLGDISHQQRQLISSRHHGGTG
ATETRSRHSSYPTGMEEEAGMKEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF
KGLPRPKSAGTATKLWQSSSWTRAIQSWWDRNLGRGGSAPSQ
NT seq 489 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccaagtgagcaggaagactccagctccgaagagagg
gccctgggccccacccccacaggggaccggctaggccccagttcaccaggaggcttcctg
ggagacatcagtcaccagcagaggcagctgatcagcagcagacaccatggaggcactggg
gctacggagacccggagtcgccacagctcataccccacggggatggaggaggaggcgggg
atgaaggaggagcccagtccattccggggccgctcacgctcagcgcctcccaatctctgg
gctgcacagcgctatggcagagagctccggaggatgagcgatgagttcgtggactccttc
aagggtcttcctcgcccgaaaagcgcgggcacagcgacgaagctgtggcagagctccagt
tggacacgcgccatccagtcctggtgggatcggaacttgggaagaggaggctccgccccc
tctcagtga

DBGET integrated database retrieval system