KEGG   Halorhodospira halophila: Hhal_0827Help
Entry
Hhal_0827         CDS       T00462                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hha  Halorhodospira halophila
Pathway
hha00250  Alanine, aspartate and glutamate metabolism
hha00410  beta-Alanine metabolism
hha00640  Propanoate metabolism
hha00650  Butanoate metabolism
hha01100  Metabolic pathways
hha01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Hhal_0827
   00650 Butanoate metabolism
    Hhal_0827
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hhal_0827
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hhal_0827
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hha01007]
    Hhal_0827
Enzymes [BR:hha01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Hhal_0827
Amino acid related enzymes [BR:hha01007]
 Aminotransferase (transaminase)
  Class III
   Hhal_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABM61603
UniProt: A1WV91
LinkDB All DBs
Position
complement(908178..909446)
Genome map
AA seq 422 aa AA seqDB search
MSDAHKTGAISPLLKQSSDVVAERGEGAYIIGTDGRRYLDFTSGIGVTATGHCHPKVVEA
AQRQAATLVHGQYAIVRHPPMLRLAERLGEIMPGAIDRIFFSNAGTEACEGALRLARQAT
GRPNIIVFQGGFHGRTMGSLSMTSSSVGLRAGVQPMMGGTVFAPFPNARRYGWEDEETAE
FCLRELDHILATQSMPAESAAFFVEPIQGEAGYIPAGRTFMQGLCERADRHGMLLIADEV
QSGYGRSGAFWAHSHFDVQPDMVVTAKGLASGFPLSAVAAPQAIMERGWPASQGGTYGGN
AVACAAALASLEVIEEEGLVENAREQGAHLRSRLDALCAEEPAIAHVQGMGLMHGTELVD
EQGRPDGDRAARVLKAMEERDVLMIRCGPQGQIVRWLPPLIIRREEVDRAVDAFAEALRA
TA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcgcacaagaccggagccatctcccccctgctcaagcagtccagcgacgtc
gtcgccgaacgcggcgaaggcgcctacatcatcggcaccgacgggcgccgctatctggac
ttcacctcgggcatcggcgtcaccgccaccgggcactgccaccccaaggtggtcgaggcc
gcccagcgccaggccgccaccctggtccacggccagtacgccatcgttcgccatccgccc
atgctccgcctcgccgagcgcctcggtgagatcatgcccggagccatcgaccgcatcttc
ttctccaacgccggcaccgaggcgtgcgagggcgccctgcgcctggcccgccaggccacc
ggccggcccaacatcatcgtcttccaggggggcttccatggccgtaccatgggctcgctg
tcgatgacctcctccagcgtcggcctgcgcgccggcgtgcagccgatgatgggcggcacg
gtgttcgcgccgttccccaatgcccggcggtacggctgggaggacgaagagaccgccgag
ttctgcctgcgcgagctcgaccacatcctcgccacgcagtcgatgccggccgagtcggcg
gcgttcttcgtcgagccgatccagggcgaggccggctacatccccgccgggcggaccttc
atgcagggcctgtgcgagcgggccgaccgccacggcatgctgctcatcgccgacgaggtg
cagagcggctacgggcgcagcggcgccttctgggcgcacagccacttcgacgtgcagccg
gacatggtggtcaccgccaaggggctggccagcggcttcccgctctcggcggtggcagcg
ccgcaggcgatcatggagcgcggttggcccgcctcccaggggggcacctacggcggcaac
gcggtcgcctgtgccgccgcgctggcgtcgctggaggtcatcgaagaggaaggcctggtg
gagaacgcccgcgagcagggcgcacacctgcgcagccggctcgacgccctgtgtgccgag
gagccggccatcgcccacgtccagggcatgggcctgatgcacggcaccgagttggtggac
gagcagggccgcccggacggcgatcgcgccgcgcgggtgctcaaggccatggaagagcgc
gatgtgctgatgattcgctgcgggccgcagggacagatcgtgcgctggctgccgccgctg
atcatccgccgcgaggaggtcgatcgcgcggtggatgcctttgccgaggcgttgcgcgcc
acggcctga

DBGET integrated database retrieval system