KEGG   Halorhodospira halophila: Hhal_0982Help
Entry
Hhal_0982         CDS       T00462                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
hha  Halorhodospira halophila
Brite
Enzymes [BR:hha01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Hhal_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ABM61758
UniProt: A1WVP6
LinkDB All DBs
Position
complement(1053971..1055074)
Genome map
AA seq 367 aa AA seqDB search
MPEASLVEDALARNKARHEHYAGLDYVRLTDGFSGWPRGTVFLDGRAVPGYPSIGRVLNL
EQGLAQHFRAPFHAEEKIDGFNVRLVRHRGQDLAFSRGGFVCPFTTDRLPDLIDPAVFQA
EPDLVLCAEVAGPGNPYLEGHPPEIHEDVALLVFDLMRWDHAEFMAVEERRALLQEHGLP
EVPYHGRFTVDQAGALRELIAGLDARGVEGVVLKEEGDRRKRAKYVTPASVVQDLGAMGD
ALLDLPPEYFTNRLMRLVLILEESPELDRETLRAELGAALIDPLLNAAREHRETHKVAHH
FCSRFRHRANAERFAEHLRRVPQSQIHTTVRSLEQAADGYWELRFDRVFPRISGLLGNFL
SGGQVYD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcttcgctggtcgaggacgcgctggcccgcaacaaggcgcggcacgagcac
tacgccgggctggattacgtccggctcaccgacggcttctccggctggccgcgggggacc
gtcttcctcgacgggcgcgccgtgcccggctacccctccatcggtcgtgtgctgaacctg
gagcagggcctggcgcagcacttccgggccccgttccacgccgaggagaagatcgacggc
ttcaacgttcgcctggtccgccatcgcggccaggatctcgccttctcgcgcggcggtttc
gtctgccccttcaccacggaccggttgcccgatctcatcgaccccgccgtctttcaggcc
gagccggatctggtgctctgcgctgaagtggcggggccggggaacccgtacctggagggg
catccgccggagatccacgaggacgtagcgctgctggtcttcgatctgatgcgctgggac
cacgccgagttcatggcggtcgaggagcgccgcgcgttgctccaggagcacggactgcca
gaggtgccgtatcacggccggtttactgtcgatcaggccggggccctgcgcgagttgatc
gccgggctcgacgcgcgcggcgtggagggggtggtgcttaaggaggagggggatcggcgc
aagcgggccaagtacgtcacccccgcctcggtggttcaggacctcggtgccatgggggat
gcgctgctcgatctgcccccggagtacttcaccaatcggctgatgcgcctggtgctgatc
ctggaggagtcgccggaactggaccgcgaaacgctgcgcgccgaactcggcgcggcgctc
atcgatcccctgctgaatgccgcccgcgagcaccgcgagacccacaaagtggcccaccac
ttctgcagccgcttccgccaccgggccaatgccgagcggtttgccgagcatctgcgccgg
gtgccgcagagccagatccacaccaccgtccgcagcctggagcaagccgccgacggctac
tgggagctgcgcttcgaccgggtcttcccgcggatcagcgggctgctgggcaacttcctc
agcggtgggcaggtctacgactag

DBGET integrated database retrieval system