KEGG   Halorhodospira halophila: Hhal_2088Help
Entry
Hhal_2088         CDS       T00462                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hha  Halorhodospira halophila
Pathway
hha00473  D-Alanine metabolism
hha00550  Peptidoglycan biosynthesis
hha01100  Metabolic pathways
hha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Hhal_2088
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hhal_2088
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Hhal_2088
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hha01011]
    Hhal_2088
Enzymes [BR:hha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Hhal_2088
Peptidoglycan biosynthesis and degradation proteins [BR:hha01011]
 Precursor biosynthesis
  Amino acid ligase
   Hhal_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_YheCD Minor_tail_Z
Motif
Other DBs
NCBI-ProteinID: ABM62852
UniProt: A1WYU0
LinkDB All DBs
Position
complement(2291938..2292852)
Genome map
AA seq 304 aa AA seqDB search
MSGIPDPQRVGRVAVLMGGTSAERDISLRSGGAILAALQRCGYDAEAYDPRDRALEGLRG
YDVVFIALHGRGGEDGTVQGLLDLLGIPYTGSGVLGSALGMDKWRCKRLWQGSGLPTPAG
QLLTGDRPVLDEGVGYPVIVKPAREGSSLGMSRVEGPEELAEAYRVAAAYDDTVLAEAWV
EGEEYTVALLGDQALPSIRLETPHAFFDYAAKYQAEDTGHHCPSGLGPEEEAELGALCRE
AFIASGGNGWGRVDVMRDTGGRWWLLEVNTIPGMTDHSLVPIAAAQAGIGFDELVARILG
EALR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggtatcccggatccgcagcgggtggggcgcgtcgccgtgctgatgggcggcacc
tcggccgagcgggacatctccctgcgcagtggcggcgcgatactcgcggcgctacagcgc
tgtggctacgacgccgaggcctacgatccccgtgaccgcgccctggaagggctgcgcggc
tacgacgtggtcttcatcgcccttcacgggcggggcggtgaggacggcacggtccaggga
ctgctggatctgctcggaatcccgtacaccggcagcggtgtcctcggctcggcgctgggc
atggacaagtggcgctgcaagcggctctggcagggcagtggcctgcccacgccggcgggt
cagttgctgaccggcgaccgcccggtcctcgacgagggggtgggttacccagtgatcgtc
aagcccgcccgcgaggggtcgagcctcggcatgagtcgggtcgaggggccggaggagctg
gccgaggcctaccgcgtggcagcggcctacgacgataccgtcctcgccgaggcctgggtc
gagggcgaggagtacaccgtggcgctgctcggtgatcaggcgttgccgtcgatccgactg
gagaccccgcacgccttcttcgactacgcggccaagtaccaggccgaggacaccggtcac
cactgcccgagcggtctcgggccggaggaagaggccgaacttggcgccctgtgtcgggag
gcctttatcgccagcggcgggaacggctgggggcgtgtggatgtcatgcgggacaccggc
ggacgctggtggctgctggaggtgaataccatccccggcatgaccgatcactcgctggtg
cccatcgcggcggcgcaggccgggatcggcttcgacgagctggtggcccgcatcctgggg
gaggcgttgcgatga

DBGET integrated database retrieval system