KEGG   Halorhodospira halophila: Hhal_2097Help
Entry
Hhal_2097         CDS       T00462                                 

Definition
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
hha  Halorhodospira halophila
Pathway
hha00550  Peptidoglycan biosynthesis
hha01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hha00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hhal_2097
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Hhal_2097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hha01011]
    Hhal_2097
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hha03036]
    Hhal_2097
Enzymes [BR:hha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Hhal_2097
Peptidoglycan biosynthesis and degradation proteins [BR:hha01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Hhal_2097
Chromosome and associated proteins [BR:hha03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    Hhal_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer PIN_10
Motif
Other DBs
NCBI-ProteinID: ABM62861
UniProt: A1WYU9
LinkDB All DBs
Position
complement(2302731..2304458)
Genome map
AA seq 575 aa AA seqDB search
MSRNTRRQPALNGPPRWRLYSVVAVMAIAAGAVILRALDLQVINSEFLRDEADARHLRTV
SMPAHRGVITDRNGEPLAISSPVKSAWANPGELLEDGAAVAAVAEVLERSPAELRDFLKA
REGRHFVYLRRHLSPQVATRMRELDAPGVQLQQEFRRFYPAGEVAAQLVGFTDIDGQGLA
GVERAFEDPLSGRSGAKRVIRDPFGRTIEDVELLREPRPGEDVHLSLDRRIQYVAYRELK
RAVRGHDAEGGAAVVLDATSGEVLAMVSQPSFNPHRRAGVEPEQRRNRAVSWAQEPGSVI
KPFTIAAALSSGAVRSGQAFDTAPGTMRVGRHTVRDFLDYGELDIAGVLQKSSNVGTVKM
ALETEPRALWNTLEDIGFGERTRSGLRDEVAGQFLPAPPRGDVQRATLSYGYGVTATPLQ
LARAYAALARDGVIRPISIQAVEEPPEGRQVLDPELAAEIRGMLEAVVEPGGTGTRAAIS
GYRVAGKTGTVLKSGPSGYAEEDYLASFIGFAPASDPRLVMAVTIDQPRGDLYYGGQVAA
PVFSRVMGNALRMLNVPPDDLPELEVPVVAEREGS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaggaatacgcgccgacaacccgcgctcaatgggccgccgcgctggcggctctac
agcgtggtggcggtgatggccatcgccgccggcgcggtgatcctgcgcgctctggatctg
caggtgatcaacagcgaattcctccgcgacgaggccgatgcccgccacctgcgcacggtg
agcatgccggcgcaccggggcgtgatcaccgaccgcaacggtgagccgctggcaatcagc
tcgccggttaagtcggcctgggccaacccgggggagttgcttgaggacggcgcggcggtc
gccgccgtggccgaggtgctggagcgctctccggcggaactgcgcgatttcctgaaggcg
cgggaggggcggcatttcgtctacctgcgtcgccacctgtcgccgcaggtggcgacgcgc
atgcgcgaactggacgccccgggggtgcagctgcagcaggagttccgccgcttctatccg
gccggcgaggtggcggctcagctggtcggttttaccgacatcgatggccaggggctggcc
ggtgtcgagcgcgccttcgaggatccgctgagtgggcgcagtggcgccaagcgcgtcatc
cgcgacccgttcgggcgcaccatcgaggatgtggagctgctgcgcgagccgcgccctggt
gaagatgtccacctgtcgctggatcggcgcatccagtacgtggcctaccgcgagctcaag
cgagccgttcgcggtcacgacgccgagggaggcgcggcggtcgtgctggatgcaacgagc
ggggaggtcctggcaatggtcagccagccctcgttcaacccccatcgccgcgccggcgtc
gagcctgagcagcgccgcaaccgggcggtgagctgggcccaggagccgggctccgtgatc
aagccgttcaccattgccgcagcgctctccagcggcgcggtgcgcagtgggcaggcgttc
gacacggccccggggaccatgcgcgtcggacggcacaccgtccgtgatttcctcgattac
ggtgagctcgatatcgccggcgtgctgcagaagtccagcaacgtgggcaccgtgaagatg
gccctggagaccgagccgcgggccctatggaacaccctggaggacatcggcttcggcgag
cgtacgcgcagcggcctgcgggacgaggtggccgggcagtttctgccggcgccgccccgc
ggcgacgtgcagcgcgcgacgctctcctacggctacggcgtcaccgctacgccgttgcag
ctggcgcgggcctacgccgcgctggcccgggacggcgtcattcgcccgatctccatccag
gcggtggaggagccgccggagggccggcaggtgctcgatccggagctggcagccgagatc
cgcggcatgctcgaggcggtggtcgagcccggcggcaccgggacccgtgctgctatctcc
ggttatcgagtagccggcaagaccggcacggtcctcaagagcggccccagtggctacgcc
gaggaggactacctcgcctctttcattggtttcgccccggcgtcggacccgcgcctggtc
atggccgtgaccatcgatcagccgcgcggcgatctctactacggcggccaggtggccgcg
ccggtcttctcccgggtgatgggcaacgcgctgcgcatgctcaatgtgccgcccgacgat
ctcccggagcttgaagtgccggtcgtcgccgagagggaggggtcatga

DBGET integrated database retrieval system