KEGG   Halobacterium hubeiense: Hhub_1919Help
Entry
Hhub_1919         CDS       T04202                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hhb  Halobacterium hubeiense
Pathway
hhb00620  Pyruvate metabolism
hhb00680  Methane metabolism
hhb00720  Carbon fixation pathways in prokaryotes
hhb01100  Metabolic pathways
hhb01120  Microbial metabolism in diverse environments
hhb01200  Carbon metabolism
Module
hhb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hhb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hhub_1919 (ppc)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hhub_1919 (ppc)
   00680 Methane metabolism
    Hhub_1919 (ppc)
Enzymes [BR:hhb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Hhub_1919 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HGD-D
Motif
Other DBs
NCBI-ProteinID: CQH53057
UniProt: A0A0U5H2Y6
LinkDB All DBs
Position
I:complement(848867..851548)
Genome map
AA seq 893 aa AA seqDB search
MDLHSRSVREDVRELGATLGDAMRAHESPAAYDAVEAARTAAIDYRRGDSDDRDALRAVV
ADADVDGYEDLARAFAGYFELVNLAEERERVRELRRSEAEGTLADSVRGAVDVLADAGAS
ADEVGEILDDVHVVPTFTAHPTEARRKTVKAHLKRIRELLEELDEHRLTPRERERTWRRV
EANVESLWTTRRVRERQPTPFDEARDVQFYLANAVYDVVPDVYADLDDALAARYDDPPEV
PEVLAFRSWAGSDRDGNPYVTTETTERVLDRQRRLVTERYLDDLDDLLGALSMDGTRVDS
AAAADLLDDASDEVPRVVEQVAERYPDELFRQVVAVVRERVDRVTDVQPGGYADADELLA
DVRALEDGLREAGLGKVADEHVAPFLRRVKTFGFHLAALDLRDHREKHTHAVGEALAREG
IDYDGMSEDERVEFLTEAVLQDDPVVDLEDTEGVDDETARVLGRFDALADWHREYGPDAI
DAYCISMTEEPSHVLEVVFLADQAGVLSLPDHAGLDVVPLLETRSALSNAREILGTLFEN
EAYGALVEARESTQEIMLGYSDSNKENGFLAANWQLDRAQRNLAAICEDHGVDVRFFHGR
GGSISRGGGPMNEALLALPKETVTGDVKFTQQGESIAETYGNPRIAERELEQMLNAQVRA
RHAAIAEDDPDVPDEWVAAMEEMAETAREAYRDLLDSEGFVEYFEAVTPIDVVEDLNLGS
RPASRTGERAVEDLRAIPWVFSWTQTRCVIPGWYGLGAGLAACEDDALLEEMYEEWPFFR
TTLDNAALALARSEPEITHEYAALAPDDLRERFQPRIDAEYEQARDEVLAVTGRDDLVDR
AWLRESLDRRNPYVDPLNFLQVELLDRKHRSPSAERALRLSVMGVAAGMQNTG
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcacagccgaagcgtccgcgaggacgtccgtgaactcggcgccacgctcggc
gacgcgatgcgcgcccacgagtcgccggcggcctacgacgcggtggaggccgcccgcacc
gccgccatcgactaccgacgcggcgacagcgacgaccgcgacgccctccgcgcggtcgtc
gccgacgccgacgtggacggctacgaggacctcgcgcgagcgttcgcgggctacttcgag
ctcgtgaacctcgcggaggagcgcgagcgcgtccgcgaactccgccgcagcgaggccgaa
ggcacgctcgcggacagcgtgcgcggcgcggtggacgtgctcgcggacgcgggcgccagc
gccgacgaggtcggcgagattctcgacgacgtccacgtcgtcccgacgttcaccgcgcac
ccgaccgaagcgcggcgcaagaccgtcaaggcccacctcaagcgcatccgcgaactcctc
gaagagctcgacgaacaccggctcacgccccgcgagcgcgagcggacgtggcggcgcgtc
gaggcgaacgtcgagtcgctgtggacgacccggcgcgtgcgcgagcgccagccgacgccg
ttcgacgaggcccgggacgtccagttctacctcgcgaacgcggtctacgacgtggtaccg
gacgtgtacgcggacctcgacgacgcgctcgccgcgcgctacgacgacccgcccgaagtt
ccggaagtgctggcgttccggtcgtgggcgggctcggaccgcgacggcaacccctacgtc
accaccgagacgaccgagcgcgtgctggaccgccagcgccgcctcgtcaccgagcgctac
ctcgacgacctcgacgacctgctcggcgcgctctcgatggacggcacgcgcgtggacagc
gcggcggccgccgacctcctcgacgacgccagcgacgaggttccccgggtggtcgagcag
gtcgccgagcgctaccccgacgagctgttccggcaggtcgtcgccgtcgtccgggagcgc
gtggaccgcgtgaccgacgtgcagccgggcggctacgcggacgctgacgaactgctggcg
gacgtgcgcgcgctggaggacggcctccgcgaggccggactgggtaaggtcgccgacgag
cacgtcgcgccgttcctgcggcgcgtgaagacgttcggcttccacctcgcggcgctggac
ctccgcgaccaccgcgagaagcacacgcacgcggtcggcgaggcgctcgcccgcgagggc
atcgactacgacgggatgagcgaggacgagcgcgtggagttcctcacggaagccgtcctg
caggacgaccccgtggtggacctcgaagacaccgagggcgtggacgacgagacggcgcgc
gtgctcgggcgcttcgacgcgctcgcggactggcaccgcgagtacggcccggacgccatc
gacgcgtactgcatcagcatgaccgaggagcccagtcacgtgctggaggtcgtcttcctc
gcggaccaggcgggcgtgctctcgctgcccgaccacgccggcctcgacgtcgtgccgctc
ctcgaaacccgctctgcgctgtcgaacgcccgcgagattctggggacgctgttcgagaac
gaggcgtacggcgcgctcgtcgaggctcgggagagtacgcaggagattatgctggggtac
tcggactccaacaaggagaacggcttcctcgcggcgaactggcagttggaccgtgcgcag
cgcaacctcgccgccatctgcgaggaccacggcgtggacgtgcgcttcttccacggccgc
ggcggctccatctcgcggggcggcggcccgatgaacgaggcgctgctcgcgctccccaag
gagacggtcaccggcgacgtgaagttcacccagcagggcgagtccatcgctgagacgtac
ggcaacccccgcattgccgagcgcgaactcgaacagatgctgaacgcccaagtgcgggcg
cgccacgccgccatcgccgaggacgacccagacgttcccgacgagtgggtcgcggcaatg
gaagagatggccgagacggcccgggaggcgtaccgcgacctcctcgactccgaggggttc
gtggagtacttcgaggcggtgacgcccatcgacgtcgtcgaggacctcaacctcgggtcg
cggcccgcctcccggacgggcgagcgcgccgtcgaggacctgcgcgcgattccgtgggtg
ttctcgtggacgcagacgcggtgcgtgattccgggctggtacggcctcggcgcggggctg
gccgcctgcgaggacgacgccctcctcgaagagatgtacgaggagtggccgttcttccgg
acgacgctggacaacgcggcgctcgcgctcgcgcgcagcgaacccgaaatcacccacgag
tacgccgcgctcgcgcccgacgacctccgcgagcgcttccagccgcgcatcgacgccgag
tacgagcaggcccgcgacgaggtgttggcggtgaccggccgcgacgacctcgtggaccgc
gcgtggctccgcgagagcctcgaccgccgcaacccctacgtcgatcccctgaacttcctg
caagtggaactcttggaccgtaaacaccgcagtcccagcgcggagcgcgcgctccggctg
tccgtgatgggcgtcgccgcggggatgcagaacacgggctga

DBGET integrated database retrieval system