KEGG   Halobacterium hubeiense: Hhub_2984Help
Entry
Hhub_2984         CDS       T04202                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hhb  Halobacterium hubeiense
Pathway
hhb00564  Glycerophospholipid metabolism
hhb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hhub_2984 (glpA)
Enzymes [BR:hhb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Hhub_2984 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 FAD_binding_2 3HCDH_N NAD_binding_8 FAD_binding_3 DAO_C FAD_oxidored DUF3606 ApbA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CQH59465
UniProt: A0A0U5H6V3
LinkDB All DBs
Position
I:complement(1804923..1806626)
Genome map
AA seq 567 aa AA seqDB search
MASVPHIAVVGGGSTGTGIARDLAMRGFDVTLVEQGNLTHGTTGRMHGLLHSGGRYAVAD
QASARECIAENRVLRDIASHCVEETGGLFVKRPEDSEEYFQEKLQGCEDCGIPAEVVSGE
EAREMEPHLARDVEKAIAVPDAAVDPFRLVVANAASAQEHGARVETHSTVTDLLVEGGEV
VGLEVEHDSGPGKHVHGTEGGTEEIRADHVVNATGAWAGRIGDMAGVDVAVRPSKGVMTV
MNVRQVDTVVNRCRPKGDADIVVPHETTAILGTTDVEVDDPEDYPEEQWEVDELIDTLSE
LVPMLAEARTVRSFWGVRPLYEPPDVGSDDPTDITRDFFLLDHADRDALPGMTTVVGGKL
TTYRMMAESVADHVCEHFGVDAECRTADAPLPGSEEFSVLRDYMDEFGLRSPIGRRSVER
LGSRADDVLDTDAPNPVVCECEGVTRAELQDAIEQSGSDLNAVRIRTRASMGNCQGGFCA
HRMASELHGEYDEETTRRAWDDLLQERWKGQRHALWGEQLSQAMLNYALHATTQNRDSDP
ADGDGVDFAAFDGGPDAARTDGGNRGD
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggtaccacacatcgccgtcgtcggcggcggttcgacgggcaccggcatcgcc
cgcgacctcgcgatgcgcgggttcgacgtgacgctcgtcgaacagggcaacctcacgcac
ggcaccaccggccggatgcacgggctgctccacagcggcggccggtacgccgtcgccgac
caggcgagcgcccgcgagtgcatcgcggagaaccgcgtgctccgggacatcgcgagccac
tgcgtcgaggagaccggcggcctcttcgtcaagcgccccgaggactccgaggagtacttc
caggagaaacttcagggctgtgaggactgcggcatccccgcggaggtcgtctccggggag
gaagcccgcgagatggaaccccacctcgcccgggacgtcgagaaggcaatcgccgtgccg
gacgccgccgtggacccgttccggctggtcgtggcgaacgccgccagcgcgcaggaacac
ggcgcgcgcgtcgagacgcactccacggtcacggacctgctcgtggagggcggcgaggtc
gtcggcctcgaagtcgaacacgactccggccccggcaagcacgtccacgggaccgagggc
ggcaccgaggagattcgcgcggaccacgtggtgaacgcgacgggcgcgtgggcgggccgc
atcggcgacatggcgggcgtggacgtggcggtccgtccctcgaagggggtgatgaccgtg
atgaacgtccgacaggtggacaccgtggtcaaccgctgtcggccgaagggcgacgccgac
atcgtcgtcccccacgagacgacggccatcctcgggacgaccgacgtggaagtcgacgat
cccgaggactaccccgaggagcagtgggaggtcgacgagctgatagacacgctctcggag
ctggtgccgatgctcgcggaggcgcggacggtgcggtcgttctggggcgtccgcccgctg
tacgagccgccggacgtcggcagcgacgacccgacggacatcacgcgggacttcttcctg
ctggaccacgccgaccgcgacgccctccccggcatgacgacggtcgtcggcgggaagctc
acgacctaccggatgatggccgagtcggtcgccgaccacgtctgcgagcacttcggcgtc
gacgcggagtgccggaccgccgacgcccccctcccggggagcgaggagttctccgtgctc
cgcgactacatggacgagttcggcctgcgctcgccaatcggccggcgcagcgtcgaacgc
ctcgggtcgcgcgccgacgacgtgctcgacaccgacgcgccgaaccccgtggtctgcgag
tgcgagggcgtcacgcgcgcggagctgcaggacgccatcgagcagtccggctccgacctc
aacgccgtccgcatccgcacgcgggcctcgatggggaactgtcagggcggcttctgcgcg
caccggatggccagcgaactccacggggagtacgacgaggagaccacgcggcgcgcgtgg
gacgacctcctgcaggagcgctggaagggccagcgccacgcgctctggggcgaacagctc
tcgcaggcgatgctgaactacgcgctgcacgcgaccacgcagaaccgcgacagcgacccc
gccgacggcgacggcgtggacttcgccgccttcgacggcggtcccgacgcggcccgaacg
gacggagggaaccgtggcgattga

DBGET integrated database retrieval system