KEGG   Ectothiorhodospira haloalkaliphila: M911_04345Help
Entry
M911_04345        CDS       T03059                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hhc  Ectothiorhodospira haloalkaliphila
Pathway
hhc00061  Fatty acid biosynthesis
hhc00780  Biotin metabolism
hhc01100  Metabolic pathways
hhc01130  Biosynthesis of antibiotics
hhc01212  Fatty acid metabolism
Module
hhc_M00083  Fatty acid biosynthesis, elongation
hhc_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M911_04345
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M911_04345
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    M911_04345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hhc01004]
    M911_04345
Enzymes [BR:hhc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     M911_04345
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     M911_04345
Lipid biosynthesis proteins [BR:hhc01004]
 Fatty acid synthase
  Component type
   M911_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AHK78540
UniProt: W8L3M9
LinkDB All DBs
Position
complement(889513..890301)
Genome map
AA seq 262 aa AA seqDB search
MGFMTGKRVLITGVASNRSIAYGIAKAMAREGAELAFTYQGDRLKDRVAKLAGECGSSIV
LPCDVSSDEQINAVFEQLGQHWDGLEGLVHAIAFAPKEALEGDFLDGMSREAFNTAHDIS
SYSLAALAKAARPMMKGRDASILTLSYLGAVRSMPNYNLMGLAKASLEANVRFLAYTLGP
EGVRVNGISAGPIRTLAAAGIGDFRKILDHVENNAPLRRNVTIEQVGNAAAFLCSDLASG
ITGEITYVDSGYSTLGLGPAEV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcatgaccggcaagcgggtgctcatcacgggcgtggccagcaaccgctccatc
gcctatggcattgccaaggccatggcgcgtgagggcgcggaactggccttcacctaccag
ggcgatcgcctgaaggatcgggtggccaagctcgccggggaatgcggctccagcatcgtg
ttgccctgcgatgtatccagcgacgaacagatcaatgcggttttcgagcaactgggtcag
cactgggatggactggagggcctggtacatgccatcgccttcgcccccaaggaggccctg
gagggtgatttcctggatggcatgtcccgggaggccttcaacaccgcccatgacatcagc
agctacagcctggcggccctggccaaggcggcccggcctatgatgaagggccgggatgcg
tccatcctcaccctgtcctacctgggcgccgtgcgttccatgcccaactacaacctcatg
ggcctcgccaaggccagcctggaggccaacgtgcgttttctggcctacaccctgggcccg
gagggcgtgcgcgtgaacggcatctccgccggccccatccgcaccctggccgccgccggc
atcggcgacttccgcaagatcctggaccatgtggagaacaatgccccgctgcgtcgcaac
gtgaccatcgagcaggtgggcaacgccgccgcgttcctgtgctcggacctggcctcgggc
atcaccggggagatcacttacgtggactccggctacagcaccctggggctggggccggcg
gaggtgtga

DBGET integrated database retrieval system