KEGG   Ectothiorhodospira haloalkaliphila: M911_09165Help
Entry
M911_09165        CDS       T03059                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
hhc  Ectothiorhodospira haloalkaliphila
Pathway
hhc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhc01100  Metabolic pathways
hhc01110  Biosynthesis of secondary metabolites
hhc01130  Biosynthesis of antibiotics
hhc01230  Biosynthesis of amino acids
Module
hhc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M911_09165 (aroK)
Enzymes [BR:hhc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     M911_09165 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 Cytidylate_kin AAA_28 AAA_22 AAA_25 AAA_16 AAA_24 dNK CoaE AAA TsaE CHDNT AAA_5 ABC_tran AAA_29 RNA_helicase AAA_17 RsgA_GTPase IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AHK80699
UniProt: W8KLQ1
LinkDB All DBs
Position
1893141..1893710
Genome map
AA seq 189 aa AA seqDB search
MPEKSNIVLIGPMGAGKSTVGRHLASHLHLPFVDSDREIERRMGVDIPTIFEYEGEDGFR
QREAAVIADLCSREGIVLATGGGVVMRPENRECLKRCGLVVYLRTSVSVQLRRTARDRNR
PLLQTENPRARLEELLRIRDPLYREIAHLVVDTDREHLRGTVRTVARRFRGRLPKPDKAR
SRTPVSAPE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgccggaaaaatccaacatcgtcctgatcggacccatgggggccggcaaatccaccgtg
ggtcgacacctggccagccacctgcacctgccctttgtggacagcgatcgggaaatcgag
cgccgcatgggcgtggacatccccaccatctttgagtacgagggcgaggatggctttcgc
cagcgtgaagcagcggtgatcgccgacctgtgcagccgcgagggcatcgtcctggccacc
ggtgggggcgtcgtgatgcgcccggaaaaccgggaatgcctgaaacgctgtggcctggtg
gtgtatctgcgcacctccgtgtcggtacaactgcggcgcaccgcccgggatcgcaaccgc
ccgctgctgcaaacggaaaacccccgtgcccggctggaggagctgctcaggattcgcgac
ccgctgtaccgggagatcgcccacctggtggtggacaccgaccgggaacatctacgcggc
acagtgcgcaccgtggcccggcgcttcagaggtcgcctccccaagccggacaaggcccgc
tcccggacacccgtttccgccccggagtga

DBGET integrated database retrieval system