KEGG   Ectothiorhodospira haloalkaliphila: M911_09170Help
Entry
M911_09170        CDS       T03059                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
hhc  Ectothiorhodospira haloalkaliphila
Pathway
hhc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hhc01100  Metabolic pathways
hhc01110  Biosynthesis of secondary metabolites
hhc01130  Biosynthesis of antibiotics
hhc01230  Biosynthesis of amino acids
Module
hhc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M911_09170
Enzymes [BR:hhc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     M911_09170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AHK79287
UniProt: W8KQK6
LinkDB All DBs
Position
1893758..1894849
Genome map
AA seq 363 aa AA seqDB search
MDTLTVDLAERSYPIHIGRGLLKEPGHFEALLKGRRAVIVTNETVAPLYLDTLKQTLAAV
HDGPVEALILPDGEQYKNVDTLNRIYTFLLERRLDRSAMLIALGGGVIGDITGFAAATYL
RGVDFIQVPTTLLSQVDSSVGGKTGVNHALGKNMIGAFHQPRLVVIDTDTLNTLPDRELS
AGLAEVIKYGLIDDADFFVWLEEHLPRLLAREPEALAWAIHRSCADKARVVAQDERESGR
RALLNLGHTFGHAIENGMGYGQWLHGEAVGAGMIMAAHLSRQMHWIDDDDLNRTTHLIQA
ARLPVAPPTGLSAERFKQIMAGDKKVLQGQLRLVLLQGIGTSVVTADFDPGALDNTLNAL
TRP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggacaccctcaccgttgatcttgccgaacgcagctacccgatccacatcggccggggg
ctattgaaagagccggggcacttcgaggccctgctgaagggtcgccgtgcggtcatcgtg
accaacgagaccgtcgcccccctctacctggacaccctcaagcagaccctggcggccgtg
catgacggcccggtggaggccctgatactgcccgatggcgagcagtacaagaacgtcgac
accctcaaccgcatctacaccttcctgctggagcgacgcctggaccgtagcgccatgctc
attgcactgggaggcggtgtgatcggagatatcaccggctttgccgccgccacctaccta
cgcggcgtggacttcattcaggtacccaccaccctgctctcccaggtggattcctcggtg
ggcggcaagaccggcgtgaatcatgcgctgggcaagaacatgatcggcgccttccatcag
ccccggctggtggtcatcgacacggataccctcaacaccctgcccgaccgggaactcagc
gccggcctggccgaggtgatcaagtacggcctgatcgacgatgcagacttcttcgtctgg
ctggaggaacacctgccacgcctgctggcccgggaacccgaagccctggcctgggccatc
caccgctcctgcgccgacaaggcccgggtggtggctcaggatgagcgggagtcaggacgc
cgtgcgctgctgaacctgggtcacaccttcggccatgccatcgaaaacggcatgggctat
ggccagtggctgcacggcgaggcagtgggcgccggcatgatcatggcggcccacctgtcc
cggcagatgcactggatcgatgacgacgatctgaatcgcaccacccacctcatccaggcg
gcgcgcctgccggtggccccgccgacaggactgtccgcagagcgcttcaaacagatcatg
gcgggcgacaagaaggtcctgcagggccagttgcgactggtcttgctccagggcatcggc
acatccgtggtaacggcggacttcgaccccggggccctcgacaacaccctgaacgcactg
acccgcccatga

DBGET integrated database retrieval system