KEGG   Ectothiorhodospira haloalkaliphila: M911_12790Help
Entry
M911_12790        CDS       T03059                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
hhc  Ectothiorhodospira haloalkaliphila
Pathway
hhc00061  Fatty acid biosynthesis
hhc01100  Metabolic pathways
hhc01212  Fatty acid metabolism
Module
hhc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M911_12790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hhc01004]
    M911_12790
Enzymes [BR:hhc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     M911_12790
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     M911_12790
Lipid biosynthesis proteins [BR:hhc01004]
 Fatty acid synthase
  Component type
   M911_12790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AHK79885
UniProt: W8L7R1
LinkDB All DBs
Position
2645281..2645793
Genome map
AA seq 170 aa AA seqDB search
MRKNSYERDELLQCGHGQMFGPGNAQLPVPNMLMMDRVTHISDEGGAYGKGEMRAELDIN
PELWFFGCHFPGDPVMPGCLGLDAMWQLVGFYLAWIGNPGRGRALGVGEVKFTGQVLPTA
GKVDYQVDVKRVITRKLVLGIADGQVFVDGRLIYTAKDLRVGLFTSTDGF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaacagctacgagcgcgacgaactccttcaatgcggccatggccagatgttc
ggccccggcaatgcccagctgccggtgccgaacatgctcatgatggaccgggtgacccac
atcagcgacgaggggggggcctatggcaagggagagatgcgcgccgagctggatatcaac
cccgaactgtggttcttcggctgccattttcccggcgacccggtgatgccgggctgcctg
ggcctggatgccatgtggcagttggtgggcttttacctggcctggatcggcaaccccggc
cgcggtcgcgccctgggtgtgggtgaagtgaaattcacgggtcaggtcctgcccaccgcc
ggcaaggtggactaccaggtggacgtcaagcgcgtgatcacccgcaagctggtgctgggc
atcgccgatggccaggtctttgtggatggccgcctgatctacaccgccaaggatctgcgc
gtgggcctgttcacctccaccgacggcttctag

DBGET integrated database retrieval system