KEGG   Halorhodospira halochloris: M911_13235Help
Entry
M911_13235        CDS       T03059                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
hhc  Halorhodospira halochloris
Pathway
hhc00630  Glyoxylate and dicarboxylate metabolism
hhc00710  Carbon fixation in photosynthetic organisms
hhc01100  Metabolic pathways
hhc01120  Microbial metabolism in diverse environments
hhc01200  Carbon metabolism
Module
hhc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M911_13235
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M911_13235
Enzymes [BR:hhc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     M911_13235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AHK79954
UniProt: W8KJH2
LinkDB All DBs
Position
2740353..2740697
Genome map
AA seq 114 aa AA seqDB search
MPFQNTMGDYQTRQTLETFGFLPALTQEEIFDQIAYVIAQGWTPSIEHIHPSQAMNHYWP
MWKLPFFGSVDLQQVVNELEACHRAYPDHHVRFTGYDNYTQSQGSAFVVFEGRR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgccattccagaacaccatgggtgactaccagacccgccagaccctggaaaccttcggt
ttcctgcctgccctcactcaggaggagatcttcgatcagatcgcctatgtcatcgcccag
ggctggacgcccagcattgagcacatccaccccagtcaggccatgaaccactactggccc
atgtggaagctgccgttcttcggcagtgtggatctgcagcaggtggtcaacgagctggag
gcctgccaccgagcctatcctgatcaccacgtccgcttcaccggctacgacaactacacc
cagagccagggctcggcgtttgtggtgttcgagggtcgtcgctaa

DBGET integrated database retrieval system