KEGG   Halorhodospira halochloris: M911_15375Help
Entry
M911_15375        CDS       T03059                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
hhc  Halorhodospira halochloris
Pathway
hhc00020  Citrate cycle (TCA cycle)
hhc00270  Cysteine and methionine metabolism
hhc00620  Pyruvate metabolism
hhc00630  Glyoxylate and dicarboxylate metabolism
hhc00680  Methane metabolism
hhc00710  Carbon fixation in photosynthetic organisms
hhc01100  Metabolic pathways
hhc01110  Biosynthesis of secondary metabolites
hhc01120  Microbial metabolism in diverse environments
hhc01130  Biosynthesis of antibiotics
hhc01200  Carbon metabolism
Module
hhc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hhc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hhc_M00012  Glyoxylate cycle
hhc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M911_15375
   00620 Pyruvate metabolism
    M911_15375
   00630 Glyoxylate and dicarboxylate metabolism
    M911_15375
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M911_15375
   00680 Methane metabolism
    M911_15375
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    M911_15375
Enzymes [BR:hhc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     M911_15375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AHK80302
UniProt: W8KTF7
LinkDB All DBs
Position
complement(3166350..3167330)
Genome map
AA seq 326 aa AA seqDB search
MKNPMRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEITPAMDALRGVVMELEDC
AFPLVAGITTSDKPEVAFDKADVALLVGARPRGPGMERKDLLEANAAIFSEQGKALNAVA
SRDVKVLVVGNPANTNSLIAQRNAPDLNPRNFTAMTRLDHNRALAQLAGKTGASTTDIKK
MIIWGNHSATQYPDISQAMVKGDAASGLVPRDWYESDFIPTVQQRGAAIIKARGASSAAS
AGSSAVDHIRDWVMGTPDGDWVSMAVPSDGSYGIEKGLIYSFPVTCKGGDYSIVQGLEVD
DFSRERMQVTEQELREERDGVAHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccccatgcgcgtcgccgttaccggcgctgctggccagatctcctacagcctg
ctgttccgcatcgcctcgggcgacatgctgggcaaggaccaaccggtgatcctgcagttg
ctggaaatcactccggccatggacgcgctgcgcggtgtggtcatggaactggaagactgc
gcgttcccgctggtggcggggatcaccacctccgacaagccggaagtggccttcgacaag
gcagacgtggccctgctggtgggtgctcgcccacgtggcccggggatggagcgcaaggat
ctgctggaggccaatgcggccatcttctccgagcagggcaaggcgctgaatgctgtggcc
agtcgcgacgtgaaggtgctggtggtgggtaaccctgccaataccaattccctgatcgcc
cagcgcaatgccccggacctgaacccgcgcaatttcactgccatgacccgtctggatcac
aaccgtgccctggcgcagttggcgggcaagaccggtgcttccacgacggacatcaagaag
atgatcatctggggcaaccattctgccacccagtacccggatatcagtcaggccatggtg
aagggcgatgccgcgtccggtctggtgccgcgggactggtacgagtctgacttcattccc
accgtgcagcagcgtggcgccgccatcatcaaggcccgtggtgcctccagcgccgcttcc
gccggcagttccgctgtggatcacatccgcgactgggtgatgggcacgccggacggtgac
tgggtgagcatggctgtgccctccgatggcagctatggcatcgagaagggtctgatctat
tccttcccggtcacctgcaagggcggggactacagcatcgtgcaggggctggaggtcgat
gatttcagtcgtgagcgcatgcaggtcacggagcaggaactgcgcgaggagcgtgacggg
gtggcacacctgctgccctga

DBGET integrated database retrieval system