KEGG   Halobacillus halophilus: HBHAL_1070
Entry
HBHAL_1070        CDS       T02031                                 

Gene name
mfd
Definition
(GenBank) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
hhd  Halobacillus halophilus
Pathway
hhd03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    HBHAL_1070 (mfd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hhd03400]
    HBHAL_1070 (mfd)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     HBHAL_1070 (mfd)
DNA repair and recombination proteins [BR:hhd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      HBHAL_1070 (mfd)
SSDB
Motif
Pfam: CarD_CdnL_TRCF TRCF UvrB_inter Helicase_C DEAD ResIII UB2H DUF3638 SecA_DEAD AAA_22
Other DBs
NCBI-ProteinID: CCG43454
UniProt: I0JH36
LinkDB
Position
68951..72487
AA seq 1178 aa
MQGIKDYLYPQDDVHSIIEGFESGMKEQMIAGLSGASRSLMISLLKESLDRPVLLVTHQL
IQAQQLYEDMQELTEEGQVQLYPVNELIASEIAIASPELRSQRIEALSNWLKQDKGILIV
PVAALKRIMPPKSYWEHNQLPFRVGEDIELNAYLEQLVSMGYERTEMVATPGEFSLRGGI
FDIYPLTAEFPYRIELFDTEVDSIRTFDSETQRSHDKLNEVTVGPATELLLHKEDFTRAY
HRLENALSHSLKKLTKADAKETLNTVIEQDLDRLKDQERFQEMYKYIGYFYEESVSLLDY
LPENGLMVLDEMSRIQETANRLDQEEAEWHQSLLEANQTVRDLNISFDWQDTWAKMKHPT
LYMSVFMRHIPNTHPQNVVNISSRQMQQFHGQMNLLKNEMERWQKQDYSIIILAPDHNRS
EKIQSVLEDYDMEAVISKSDVKLPLVKPTIVIGNISSGFEWPMHKLAVLTENELFKTRTA
KPKRKQKLSNAERIKNYQELKVGDYIVHANHGIGKYLGIETLEMNGNHKDFLMVNYSGND
KLYVPIDQIDLIQKYVGSEGKEPKIYKLGGSEWNKVKRKVQSSVEDIADDLIQLYAEREA
SKGHAFSEDGEMQKDFEIAFPYEETEDQVRCIEEIKEDMERIRPMDRLLCGDVGYGKTEV
AIRAAFKAIYEGKQVAILVPTTILAQQHYETLQERFQGFGINLGLMSRFRTRKQQKETTD
RLRKGLVDIIVGTHRILSKDVQFKDLGLLIVDEEQRFGVKHKEKIKQLKHNVDVLTLTAT
PIPRTLHMSMLGVRDLSVIETPPANRFPIQTYVLEYNPIFLREAIEREMARGGQVFFLFN
RVENIERMAQEIAALVPEARVTFAHGQMNETELENVMFSFLGGEYDVLVSTTIIETGVDI
PNVNTLIVYDADRMGLSQLYQLRGRVGRSNRVAYAYFTYQRDKVLTEVAEKRLQAIKEFT
ELGSGFKIAMRDLSIRGAGNLLGSQQHGFIDSVGFDMYSQMLKDAIEAKRQGKEQEAVQP
FQPELDMMMDAYIPGTYIQDEKQKIDMYKQFQAVESVEDVHDLRDELIDRFGDYPEEVEN
LFRATSIRLFAKQARIESITEKKRKLEMVMDSDQSQLIDGAKLFEYANKYGRIVQLGTED
NQLKVTFKWDRQPQAKRYEIVEEFLSQLPSMIRETTTA
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgcaaggaattaaagattatttatatccccaggatgatgtccattcaatcatagagggc
tttgaatcagggatgaaggaacaaatgattgcaggattgtctggagcatcacggagttta
atgatctccttgcttaaggaatcattggaccgccctgtcctgcttgttacccatcaattg
attcaagctcagcagctgtatgaggacatgcaagaactgaccgaggagggccaggttcaa
ttatatcccgtaaacgaactgatcgcctctgaaattgcgattgcaagtcctgaattaaga
agtcagagaattgaggccttgagcaactggctgaagcaagataaagggattcttattgtc
cctgtagctgctctaaaacgcatcatgccgccaaaatcctactgggagcataatcagctc
ccttttcgtgttggggaagatattgagctgaacgcgtatttggagcagctggtgagtatg
gggtatgaacgtacagagatggtagctacccccggagagttctccctgcgtgggggaatc
tttgatatttatccgttaacggcagaatttccttaccggattgaactgtttgataccgaa
gtagattcgattcgtacatttgattcggaaactcagaggtcgcacgataaactgaatgaa
gttacggtaggacctgccactgaattactgctgcataaggaagactttacgagggcatat
catcgattggaaaatgcgctcagccactccctgaaaaagttgacgaaagcggatgcaaaa
gaaaccttgaacaccgtgattgagcaggacctggaccgtttgaaagatcaggaacgcttt
caggagatgtataaatacattggttatttttatgaagagtctgtaagtctgctagactat
cttcctgagaatggactgatggttctggacgagatgagccgtattcaagaaaccgctaac
cgtcttgaccaggaagaagcggaatggcatcaaagcctattagaagcaaaccagacggtc
cgcgacttgaacatctcttttgactggcaggacacgtgggccaagatgaagcatcctacc
ctatatatgtccgtattcatgcgtcatattccaaatactcaccctcagaatgtagtcaat
atttcaagccgtcaaatgcagcaatttcacgggcagatgaatttattgaagaatgaaatg
gagaggtggcagaagcaggattattcaattattattctggctcctgatcacaaccgtagt
gaaaagatccagtcggttttagaagattatgatatggaagctgtcatctctaaatcagat
gttaagctgcctctagtgaagccgacaattgttatcgggaatatcagcagcggctttgaa
tggcctatgcataaattggccgttctgaccgaaaatgaactgtttaaaactcgcacagcc
aagcccaaacgtaagcagaagctttccaatgctgaacgcatcaagaattaccaggagctt
aaagtgggagactatatcgtccacgctaatcacgggattggtaaatacttaggtatagaa
acacttgagatgaatggcaatcataaagattttctaatggttaattattcaggtaatgat
aagctgtatgtcccgatcgaccagattgaccttattcaaaaatatgtgggttctgaaggg
aaagagcctaaaatatacaagctcggtggcagtgagtggaataaagtcaagcgcaaggtt
caatcttcagtagaggatattgccgatgacttaattcagctttacgcagagcgggaagct
tctaaaggtcacgcgttcagtgaggatggcgaaatgcaaaaagattttgagatcgctttt
ccttatgaagaaaccgaggaccaggtgcgttgtatagaagaaattaaggaagatatggaa
cggattcgacctatggaccgcttgttatgcggagatgtcggatacggtaaaacggaggta
gcgatccgagcagcctttaaagcgatttatgaaggcaaacaagtggcgatccttgtacct
accaccatattggctcagcagcattatgaaacccttcaggagcgcttccaagggtttggt
attaacctgggattaatgagccgcttccgcacgcgcaagcagcaaaaagaaacgacagac
agacttagaaaaggattggtggatattatcgtgggcacccaccggattctttcaaaggat
gtacaatttaaagatctggggctgctgattgtagacgaagagcagaggtttggcgtgaag
cacaaagaaaaaatcaaacagctaaagcataatgtggatgttctgacattaacagccact
ccaattcctcgaacacttcatatgtcgatgctcggcgtccgcgatttatcggttattgaa
acgccgcctgcgaaccgttttcctattcaaacgtacgtcctggaatataatccaattttc
ctgcgggaagcgattgaaagagaaatggcgcgcggcgggcaagtctttttcttatttaac
cgtgtggaaaatatcgaacggatggctcaggaaatcgctgcgctcgtccccgaagcccgc
gtaacattcgctcatgggcaaatgaatgaaacggagcttgagaatgtcatgttttccttc
ttgggaggggaatatgatgtacttgtgagtaccaccattatcgaaacaggagtcgatatt
cctaatgtaaatacccttattgtttacgatgcagatcgtatgggcttaagccagctttat
caacttcgcggccgtgtaggccgttcgaaccgtgtggcttatgcttactttacctaccaa
cgggataaagtactgacggaagtcgctgaaaaacgtctccaggctattaaagaatttact
gaattaggctcaggttttaaaatcgccatgcgggatctttccatacgaggagcaggtaat
ttactggggtcgcaacaacatggatttattgattcagtagggtttgatatgtattcacaa
atgctgaaggatgcgattgaagcgaaaagacaaggtaaagaacaggaagccgtgcagccg
ttccagccagaattggatatgatgatggatgcttatattcctggcacatatattcaggat
gaaaagcagaagattgatatgtataaacaattccaggccgtggaatctgtagaagacgtg
catgatttacgtgatgaattgattgatcgcttcggagattatccggaagaagtggagaac
ttattcagggctacttccattcgcctctttgctaaacaggcacggattgaatccattacg
gagaagaaaaggaagctcgaaatggttatggattcagaccaaagccagctgattgacgga
gcgaagctgtttgagtatgccaataaatatggtcgtatcgtacagttaggcacggaagat
aaccagttaaaagtcaccttcaaatgggatcgtcagccgcaggccaagcggtatgagatc
gtcgaggagttcttaagtcaacttccatctatgattcgtgaaacgactacagcttaa

DBGET integrated database retrieval system