KEGG   Halobacillus halophilus: HBHAL_1195Help
Entry
HBHAL_1195        CDS       T02031                                 

Definition
(GenBank) ABC-type transport system ATP-binding/permease protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
hhd  Halobacillus halophilus
Pathway
hhd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HBHAL_1195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hhd02000]
    HBHAL_1195
Transporters [BR:hhd02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    HBHAL_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 AAA_29 AAA_16 AAA_25 AAA_18 RsgA_GTPase AAA_22 AAA_33 cobW AAA_15 AAA_30 Rad17 AAA_23 G-alpha
Motif
Other DBs
NCBI-ProteinID: CCG43574
UniProt: I0JHF6
LinkDB All DBs
Position
198438..200147
Genome map
AA seq 569 aa AA seqDB search
MKDISQMIKLVALEKKDVLLSILFGFLAGMSAVGLFASSGYLISRAALVPPLYALTVLIA
FLKLFGFARALGRYAERYYSHRATFTMLSNIRVAFFEKLEPYAPRVFQKYRSGDLLARIV
GDVESLQNFFLRVYYPPVVLVVIFLSTIVFTSIFSTSIAIVLLLGLVLTGVFVPYLFSLR
QRTIENRVRESRGELSIDVTEFLFGFRDLKIYQQLEDKEERMHESSASYIREQEREGMQR
IFSHSVNTLVSLLVSWVVLGLGAYLVARGDLNGLFLAMLVMISLTVFENATPMAVLPSHL
EDSKRASGRLFSIGDEMIEDKGRLHLGGGESYGFELSGVDFHFPEEERQTLQQVNLKIPA
GSKTALVGPSGSGKSTLLQLLLKIHTSDQGDIWLNDHPMERIDEESIWNRSNVVLQENHF
FFGTVRENLQLAKDDLTDEQMLDALRDVELGSFRLDYPVFEKGENLSGGEKQRLAIARAM
LKGEQLWILDEPTSSIDALTERKIYERLFNQAERDTLILVSHRLTGLELMDQIIVMDEGT
IVEKGTYHELMHKQGYFYEMKQIEKTIFG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacataagccaaatgattaagcttgtggcattggagaaaaaagatgttttgtta
tcgattttgtttggttttctagctggaatgtcggctgtcgggctttttgcctcaagtggc
tatttgatttcgcgagccgctcttgtcccgccgctatatgccctcacggtcctgattgcc
ttcttaaaattattcgggtttgcaagggctttgggacgttatgcggagcgttactattcc
catcgcgcgactttcacgatgttaagtaatattcgggtggccttttttgagaaactggag
ccttatgctccgcgtgtttttcaaaaatacaggagtggtgatctgctggctcggattgtg
ggagatgtggaaagtctgcagaactttttcctcagggtctattatcctccggtagttctc
gtggttatctttttaagcacgattgtgtttacatcaatcttttctacatccattgcaatc
gtactgcttcttgggctggtccttacaggagtgtttgttccctatttattttcattacgg
cagagaacgattgaaaatagagtaagggaatcgcgaggagaattatcgatagatgtaacg
gaatttctttttggattccgtgatttgaaaatctatcagcaattggaggataaagaagaa
cggatgcatgaatcctctgcttcttatattagagaacaggagcgggagggtatgcagaga
atcttcagccattctgttaatacactcgtgtctttactagtctcatgggtggtattggga
ctgggtgcttatttggttgccaggggcgatttaaatggcttgtttttagcgatgcttgtg
atgatttcgctgacggtatttgaaaatgctactcccatggccgtccttcccagtcactta
gaagacagtaaacgtgcttccggacgactgttttccataggcgatgaaatgattgaggat
aaaggcaggctgcatctgggtggcggggagtcatacggatttgaattgagcggagtagat
tttcattttcctgaggaagagcggcagactttgcagcaagtaaatttgaaaattccagcc
ggttccaagactgctctcgtcggtccaagtgggtcaggtaaatcaactttactgcagttg
ctcttaaaaattcatacctctgatcaaggggatatctggttgaatgaccatccaatggag
cgcattgatgaagagagtatttggaacaggagcaatgtcgttttgcaggaaaatcacttc
ttttttggtactgttcgggagaacctgcaattagctaaagatgaccttacggatgagcaa
atgctggacgcactccgtgacgtagagcttgggtctttccggttggactaccccgtattt
gaaaagggagaaaatctctctggtggagaaaaacagcgtctggcaattgcgcgggcgatg
ctgaaaggggaacaactctggatactggatgaacctacttcttctatagatgctctaact
gagcggaaaatttatgaacgtttgtttaatcaggcggaaagggatactctgatcctggtt
agtcaccgtcttacaggtcttgaactcatggatcagattattgtgatggatgaaggtacg
attgtggaaaaaggaacttaccatgaattgatgcataagcaaggctacttctatgaaatg
aaacaaatcgaaaaaaccatcttcggataa

DBGET integrated database retrieval system