KEGG   Halobacillus halophilus: HBHAL_1394Help
Entry
HBHAL_1394        CDS       T02031                                 

Gene name
alr1
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00473  D-Alanine metabolism
hhd01100  Metabolic pathways
hhd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HBHAL_1394 (alr1)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HBHAL_1394 (alr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hhd01011]
    HBHAL_1394 (alr1)
Enzymes [BR:hhd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HBHAL_1394 (alr1)
Peptidoglycan biosynthesis and degradation proteins [BR:hhd01011]
 Precursor biosynthesis
  Racemase
   HBHAL_1394 (alr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCG43766
UniProt: I0JHZ8
LinkDB All DBs
Position
396072..397229
Genome map
AA seq 385 aa AA seqDB search
MSIETFYRDSWAEVDLSKIDYNIRQLQGRLSAGTEIYAVVKANAYGHGDIQVAHQALKSG
AKALAVSLLDEAIRLREAGIEAPILVMGWTRPEDAVTASEYRVSVTVFQKEWMEKVQHFH
FEKPLKLHMKWDTGMGRIGVRTTKEMDDILDHFRNNPTFELEAVFTHFATADEEETGYFE
EQERRFKHLFSHFERVWQENVEIHTGNSAASMRFPDRMKNFVRFGISMYGLYPSDVVKEE
RPIALEPAFSLQSRLIHVKKLDAGEAVSYGATYHTRKEEWIGTIPLGYADGWIRKLQGME
VLVDGKRHPIVGRICMDQFMIRLDQEYPLGTKVTLIGKQGAHEITTDEVADYLETINYEI
PCMISYRVPRMFFENGHMVEVDNPL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaatagaaactttttatcgagattcctgggcggaagtggatctgtccaagattgat
tataatatccggcagttacaggggcgcctttcagctggaactgaaatctatgcggttgta
aaagccaatgcgtatggacatggggatatccaggttgctcatcaggcgttgaagtctggt
gcaaaggctcttgcggtttcccttttagatgaagcaatccgccttcgggaagcgggaata
gaagctcctatattagtaatgggatggactcggccggaagacgctgtaacagcttcagaa
tacagggtttcggttaccgtttttcaaaaagaatggatggaaaaagtgcaacattttcat
tttgaaaaaccgctgaagctgcatatgaaatgggatacaggaatgggcagaattggagtt
cgcacgacaaaggaaatggatgatattctcgatcatttccgaaataacccgaccttcgaa
ttagaagcggtgttcactcatttcgcgacggcggatgaagaggaaacgggatatttcgaa
gaacaggaacggcggtttaagcatctattttcccattttgaaagggtttggcaggaaaac
gtcgaaatccatacagggaatagtgcggccagtatgagatttccagaccgaatgaagaac
tttgtccggtttggaattagtatgtacggcttgtatccgtcagatgtggttaaagaagag
cgtcctatcgctttagaacctgccttttccctgcagagccgattaattcatgtaaaaaaa
ttggatgcaggagaggcggtcagttatggagcaacgtatcatacccgaaaagaagaatgg
atcggtactattcctcttggttatgctgacggatggatacggaaattacaggggatggaa
gtactggttgacggcaaacgtcacccgatcgtcggaaggatctgtatggatcaatttatg
attcgtcttgatcaggaatatcctttgggcacaaaggttaccttaattggtaaacagggg
gctcacgagattaccacggatgaagtggcggattatcttgaaaccatcaattatgaaata
ccctgtatgattagctacagggttccgagaatgttttttgaaaacggccatatggtggaa
gtagataatcctctataa

DBGET integrated database retrieval system