KEGG   Halobacillus halophilus: HBHAL_1451Help
Entry
HBHAL_1451        CDS       T02031                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hhd  Halobacillus halophilus
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HBHAL_1451 (ahpF)
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HBHAL_1451 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_oxidored FAD_binding_2 DAO Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 NAD_binding_7 Glutaredoxin Thioredoxin_4 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: CCG43823
UniProt: I0JI55
LinkDB All DBs
Position
complement(467830..469362)
Genome map
AA seq 510 aa AA seqDB search
MVLDAQIKAQLEEYLKLLEGDIELKVSAGDDDVSRDMLALTDELASMSPKITVTNAELKR
TPSFSVNRPQEETGITFAGVPLGHEFTSLVLALLQVSGRPPKIDDTMVEQIKNISGEYKF
ETYVSLSCHNCPDVVQALNIMSVINPGITHTMIDGAAFKEEAEENNVMAVPAVYLDGEFF
SGGRITLEEIVAKISDGPSPEEFTNRDPYDVLVVGGGPAGASAAIYAARKGIRTGVVAER
FGGQVLDTMTIENFISVKNTEGPKFAASLEEHVKDYDIDIMNLQRVKGLEKNDGMFEIEL
DNGGVLKSKSAIISTGARWRQIGVPGEEEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSG
VEAAIDLAGIVQNVTVLEFADELKADEVLQERLNSLPNVNVKTNAQTTEITGDENVNGIT
YIDRESGEEQHIALQGVFVQIGLVPNTEWLDADVETNRIGEIITNKQGSTNLPGLFAAGD
VTDCPNNQIIISMGDGANASLGAFDYLIRN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggttctagatgcacaaataaaagcacaattagaagaatatctaaagcttttagaaggt
gacatcgaactgaaagtcagcgcgggagacgatgatgtctcccgcgacatgctggctctc
accgatgagcttgcctccatgtcaccgaaaattaccgttacaaatgcagaacttaaacgc
acacccagcttcagcgtaaaccgtcctcaagaggaaacaggaattacctttgccggtgtt
ccgcttggtcatgaattcacatcgttagtgcttgctttacttcaagtaagcggaagacct
ccaaaaattgatgatacaatggtggaacaaattaaaaacatcagcggagaatataaattt
gagacttatgtaagcttaagctgtcataactgccctgatgtggtacaggctctaaatatt
atgagcgtaataaaccctggcatcactcataccatgattgatggcgctgctttcaaagaa
gaagcagaagaaaataatgtaatggcagttccagcggtttatcttgatggagaattcttc
agcggcggacgtataactcttgaagaaatcgttgcaaaaatcagtgacggtccatctcca
gaagaatttacaaaccgtgacccatacgatgtgttagttgtcggcggtggccctgcaggt
gccagtgctgctatttatgctgcacgtaaaggaatccgcacgggagttgtggccgagcgc
ttcggcggtcaggtccttgataccatgaccatcgagaactttatcagtgtcaaaaataca
gaaggaccgaaattcgcagcaagccttgaagaacacgtgaaagactatgatatcgatatc
atgaaccttcaacgtgtcaaaggtttggaaaagaatgacggcatgttcgaaattgaactt
gataatggtggtgttctgaagagtaagagtgccattatctctacaggtgcacgctggcgc
caaatcggcgtgccaggtgaagaagagttcaagaacaaaggtgtagcctactgccctcac
tgtgacggtccattgttcgaaggcaaagacgtagcggtcatcggcggcggaaactccggc
gttgaagcagctatcgaccttgccggtattgttcaaaacgttactgtacttgaatttgcc
gacgagctgaaagcggatgaggttctccaagaacgactaaatagtcttccaaacgttaat
gtgaagacaaatgctcaaactacagaaatcaccggtgacgaaaacgtaaatggtattacg
tatatcgatcgtgaatctggtgaagaacagcacattgcccttcagggtgtcttcgttcaa
attggtcttgtcccaaatacagaatggttagacgcagacgtagaaaccaaccgcattggt
gaaatcatcaccaataagcaaggttctacgaatctacctggtctgtttgcagccggtgac
gtaaccgactgtccaaacaatcagattattatttctatgggcgatggtgcaaatgcctct
cttggtgcatttgattacttgattagaaactaa

DBGET integrated database retrieval system