KEGG   Halobacillus halophilus: HBHAL_1905Help
Entry
HBHAL_1905        CDS       T02031                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HBHAL_1905
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     HBHAL_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 DUF373
Motif
Other DBs
NCBI-ProteinID: CCG44267
UniProt: I0JJE9
LinkDB All DBs
Position
910892..912394
Genome map
AA seq 500 aa AA seqDB search
MSQKLNQEEKLQNFINGEWLEPGNGAYADVTNPATLETLVQVPLSGKEEVASAVEAAKKA
QKDWALVPAPQRAEVLYRVGLIMKERKEYLSRWLTMENGKVLEEARGEVQEGIDMAFYMA
GEGRRLFGQTTPSELKDKFAMSVRAPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWK
PASETPVMAFELAKIFEEAGLPKGVINVVFGSGSSVGEAMLEENDIRVISFTGSNEVGRG
IASKCGQKLKKVSLEMGGKNAVIVMDDADLSLAVEGILWSAFGTSGQRCTACSRVLVHES
LKDQLEERLMYEMAKLTIGNGLDESIKVGPIINQKGLEKIKSYIRVGNAEGAKLLAGGYV
LENGEHKKGHYFAPTLFTDVKADMRIAQEEIFGPVVSLIPVKSLEEAVEINNGVEFGLSS
SIFTKDINKVFAAQRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGLAALDVFTE
WKSVYVDFSGKLQRAQIDVE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcaaaagttgaaccaagaagaaaaacttcagaatttcattaatggggaatggctg
gaacctggtaatggtgcgtatgctgatgtaaccaatccggctacgcttgaaacgctggtg
caagtgccattgtctggtaaagaagaagtagcttccgctgtagaggctgccaagaaagct
caaaaggactgggcgcttgttcctgctcctcagcgtgcggaagtactttaccgtgttggt
ttaattatgaaagaaagaaaagagtacttgtcccgctggctgacgatggaaaatggaaag
gtgctggaagaagcacgcggagaagtgcaggaagggatcgatatggctttctatatggct
ggggaaggacgaaggttattcggccagaccactccatccgaactgaaggacaaattcgct
atgagtgtacgcgcccctgtgggagtggtcggaataattacaccatggaattttccgata
gccatagcgacttggaagtcgtttccggccatcgtcgcagggaatgcggttgtatggaaa
cccgcctccgaaacaccggtcatggcttttgaattagctaaaatatttgaagaagcaggc
cttcctaaaggggttatcaatgtcgtattcggttcaggttcttccgtcggggaagctatg
cttgaagaaaatgatatacgggtcatctcgtttactggttctaatgaagtggggcgcgga
attgcttctaagtgcggtcaaaaactgaaaaaagtctcactcgaaatgggaggcaaaaac
gcggtcattgttatggatgatgctgatctttcactagccgtagagggtattttgtggagc
gcatttggaacgagcggacagcgttgtaccgcctgcagccgcgtattggttcacgaaagc
ttaaaggatcaattagaagaacggctgatgtacgaaatggctaagctgaccataggtaac
ggattagatgaatcgatcaaggtaggtccgattattaatcaaaaaggacttgaaaaaata
aaaagttatattcgagtagggaatgcagaaggggccaagctgcttgcaggcggttatgta
ctggaaaatggagaacataaaaaagggcattatttcgcccctacactattcacagatgtg
aaagccgatatgcgtatcgctcaggaagaaatctttggaccggtcgtttccctgattcca
gtaaagagtctcgaagaagctgttgagatcaataacggcgtggagttcggtctctcgagt
tctatctttacgaaggatatcaataaggtttttgcagcccagcgcgatctggacacagga
attgtgtatgtaaatgcagggacaacaggcgcagagattcatcttccttttggaggaaca
aaaggaacgggcaatgggcaccgtgattccggtcttgccgctttagatgtgtttacggaa
tggaaatccgtgtatgtggattttagcggtaaattacagcgtgctcaaatcgacgtggag
tag

DBGET integrated database retrieval system