KEGG   Halobacillus halophilus: HBHAL_2984Help
Entry
HBHAL_2984        CDS       T02031                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00053  Ascorbate and aldarate metabolism
hhd00071  Fatty acid degradation
hhd00280  Valine, leucine and isoleucine degradation
hhd00310  Lysine degradation
hhd00330  Arginine and proline metabolism
hhd00340  Histidine metabolism
hhd00380  Tryptophan metabolism
hhd00410  beta-Alanine metabolism
hhd00561  Glycerolipid metabolism
hhd00620  Pyruvate metabolism
hhd00625  Chloroalkane and chloroalkene degradation
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_2984
   00053 Ascorbate and aldarate metabolism
    HBHAL_2984
   00620 Pyruvate metabolism
    HBHAL_2984
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HBHAL_2984
   00561 Glycerolipid metabolism
    HBHAL_2984
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HBHAL_2984
   00310 Lysine degradation
    HBHAL_2984
   00330 Arginine and proline metabolism
    HBHAL_2984
   00340 Histidine metabolism
    HBHAL_2984
   00380 Tryptophan metabolism
    HBHAL_2984
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HBHAL_2984
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HBHAL_2984
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HBHAL_2984
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     HBHAL_2984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF3813 VASP_tetra
Motif
Other DBs
NCBI-ProteinID: CCG45331
UniProt: I0JMG1
LinkDB All DBs
Position
1983144..1984568
Genome map
AA seq 474 aa AA seqDB search
MRNQLKHFINGEWVESTGSETYDVINPATEEVIGTISMGTEEDLDKAVAAAKQALPSFSQ
TSKQERVEMLERIAAEYEKRKDDIIETITDELGSPQKISEKVHYTMGYNHFSQAAESLKD
FSFMEDRGGHTVVKETIGVSGLITPWNFPTNQTSTKIASAFAAGSPVILKPAEMTPFAAI
ILTEIFEAAGVPKGVFNLVNGTGEVIGNGISSHPDIDFVSFTGSGAVGKKIMENASETIK
NFALELGGKSPLVVLEDADVEVAARAAVNHIATNTGQVCSAATRVLVPSKMKKSFEEAVL
KVLPEFPVGDPREDNLIGPLISKKQWDTVQSYIEKGLDEGASLLTGGTGKPDGLDQGYYA
KPTVFTDVQNNMVIAQEEIFGPVTTIITYDTLDEAIEIANETIYGLAGYVIGNDPENLRK
AATGIRAGRIKVNDTEADFSAPFGGYKQSGIGREWGDYGIEEYLETKTILGFPS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcggaatcaattaaagcattttataaacggtgaatgggtagaatcaacaggctctgaa
acctatgatgtaataaatccagctacggaagaagtaataggaacaattagtatgggtaca
gaagaagatttagataaagctgtagctgcagcaaaacaagcacttccttcattttctcaa
acttctaaacaggaacgtgtagaaatgctggaacgaattgctgcagaatatgagaaacgt
aaagatgatattattgaaaccataacggatgagttaggatcgcctcagaagatttcagaa
aaagttcattacacaatgggctacaatcatttctcacaagcggcagaatcattgaaggat
ttttctttcatggaagatcgcggtggtcatacagtagttaaagaaaccataggtgtaagt
ggtttaattacgccttggaatttccctaccaatcaaacttcgaccaagattgccagtgca
tttgcggcaggcagcccggttatcttaaaaccagcagaaatgactccatttgctgctatt
attttaacagaaatctttgaagcagcaggagttccaaaaggtgtatttaacttagttaat
ggcacaggggaagttataggaaatgggatcagttcacaccctgatattgactttgtttcc
tttactggatcaggagctgtagggaagaaaatcatggagaatgcttctgaaactattaag
aattttgcgctcgaactgggaggtaaatctccacttgttgtgttggaagatgctgatgtc
gaagtcgcagcaagagcagccgttaatcatattgcaacgaacacaggtcaagtatgctca
gctgctacaagggtgcttgttcctagtaaaatgaagaagtcttttgaagaagctgtgctg
aaagttctacctgaattccctgtaggggatccaagagaggataacctgataggtccgttg
atttccaagaaacagtgggataccgtgcagtcctatattgaaaaaggtctagatgaaggt
gcatctctattaacgggaggaaccggtaagccggatgggcttgaccaaggctattatgcc
aaacctaccgtatttacagatgttcaaaataatatggtaattgcacaagaggaaatcttt
gggccagtaaccactatcatcacatatgatacgcttgatgaagctattgaaattgctaat
gaaactatttatggtttagctggttacgtaataggtaatgacccggaaaatctaagaaaa
gcagcaactggaattcgtgcaggtcgtatcaaagtgaacgacactgaagctgatttttct
gctccattcggagggtataagcaatccggaataggaagagaatggggcgactatggtatt
gaagaatacttggaaaccaaaactatacttggatttccttcttaa

DBGET integrated database retrieval system