KEGG   Halobacillus halophilus: HBHAL_3114Help
Entry
HBHAL_3114        CDS       T02031                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00260  Glycine, serine and threonine metabolism
hhd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBHAL_3114 (tdh)
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     HBHAL_3114 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C ADH_N_2
Motif
Other DBs
NCBI-ProteinID: CCG45461
UniProt: I0JMU1
LinkDB All DBs
Position
2108041..2109081
Genome map
AA seq 346 aa AA seqDB search
MNGTMKAIVKHHRGKGAELKEVAIPSIRDDEVLIRVQATSICGTDVHIYNWDEWSESRVQ
PPYVFGHEFAGEIVEVGEKVNNFTVGDYVSAETHLVCGHCPQCLTGKSHICENTKIIGVD
TQGCFAEYVALPASNLWRNPSDLPTDIASIQEPMGNAVHTVLNGDVAGKSVAIIGCGPIG
LMAVGVAKAAGASQVLAFDLNTYRLELAEKMGATTTINSREEDPVVRAKDLTDRHGVDVV
CEMSGHPVAMDQGFKMITNGGRVSILSLPTKRVSLDVTNDIVFKGIEVQGITGRKMYETW
QQVSRLLQSGQVDVKPMITHHLKLDEFEKGFELMNQGECGKVVLHP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggaacaatgaaagcaattgttaaacaccatcgcggtaaaggagcagagcttaag
gaagtagcgattccttcaattcgtgatgatgaagtattaatacgtgtgcaggcaacttcc
atatgtggaacagatgttcatatatataattgggatgagtggtccgagagccgggtacag
ccaccttatgttttcggccatgaatttgcaggtgaaattgttgaagttggagaaaaagta
aataacttcacagtaggtgattatgtaagtgcagagacacacttagtatgcggtcactgt
cctcagtgcctgacgggtaaatcccatatatgtgaaaatactaagattattggagtagat
acccaaggctgctttgcagagtacgtagcactgccagctagtaacctatggcgcaaccca
agcgatctcccgacagatatagcctccatccaggagccgatgggcaatgctgtacacacc
gtcctcaatggcgatgtggcaggtaaatccgtggctattattgggtgcgggcctattggt
ttaatggctgtgggtgtagctaaagcagcgggagcgtcccaggtcctggcttttgatctc
aacacttatcgtctggaactagctgaaaaaatgggagctactacaacgattaactcaagg
gaagaagatcctgtagttagagctaaagatttaaccgatagacatggagtagatgtggtt
tgtgaaatgagcggccatcctgtagccatggaccagggttttaagatgatcacaaacgga
ggacgtgtgtctatattaagcctgcccacgaaaagagtgagccttgatgtaacgaatgat
attgtttttaagggaatagaggttcaagggatcacaggccgtaagatgtatgaaacgtgg
cagcaagtttcccggctgcttcaatcagggcaggttgatgttaaaccaatgattactcat
cacttaaaactggatgagtttgaaaaaggatttgaattaatgaatcaaggcgagtgcggg
aaagttgtactgcatccataa

DBGET integrated database retrieval system