KEGG   Halobacillus halophilus: HBHAL_3421Help
Entry
HBHAL_3421        CDS       T02031                                 

Definition
(GenBank) glycine oxidase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00730  Thiamine metabolism
hhd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    HBHAL_3421
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     HBHAL_3421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 HI0933_like GDI Pyr_redox_3 NAD_binding_8 Pyr_redox_2 Pyr_redox FAD_binding_3 GIDA Thi4 ApbA GMC_oxred_N NAD_binding_7 Trp_halogenase TrkA_N
Motif
Other DBs
NCBI-ProteinID: CCG45765
UniProt: I0JNP5
LinkDB All DBs
Position
complement(2389691..2390824)
Genome map
AA seq 377 aa AA seqDB search
MPKKYDTIIIGGGIIGCSTAFYLSKKGQRVLVLEKRSLGQEASSAAAGMLGVQTELEEQS
PMYELARTSREMFPNLAVELKDMTGIDIGLSQKGILRLAFTEEQRVRYREIAANQKLKGE
ESFWKDREEIVGMESCLTDSLVGGIWFPKEGHVSAPDLTQAFARAAAVNGVTFRESTDVY
QLIREQNQVVGVATDAGEFYGSAVLVAAGAWSRRFLPGKEQALYPVKGEALAVKTEKPIL
HTTIFTDDCYLVPKKGGEIIVGATSTPYTFDQRVTMEGIEGLVHKAKRLLPLLGKAEIDR
IWAGTRPMTGDGLPIMGAHPELNSLYFSTGHYRNGILLSPVTGKVMADYIAGETKLITDL
SAFSPARFQNHMEVSSL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaagtacgacacgattataattggcggagggatcataggctgttctacagct
ttttatctatcgaagaaagggcaacgggttttagttctggagaaaagatctcttggacaa
gaagcttccagtgcagctgctgggatgcttggggtccaaacggagttggaagagcaaagc
cctatgtacgaactggcgcgtacgagtcgagagatgtttccaaacttagctgtagagtta
aaagacatgactggaatagacattgggctttcacaaaaggggatattgagactagctttt
acggaagaacagagagttcgttaccgggaaatcgctgcaaatcaaaagctgaaaggggaa
gaatccttctggaaagacagagaagaaatagttggaatggaatcatgtctaacagattcg
ttagttggaggtatatggtttcctaaagaaggccatgtatcagctccagatcttacccag
gcttttgcgcgggctgcagctgtaaacggagtgacttttcgtgaatctactgatgtctat
cagttaatacgtgaacaaaatcaagtagtaggagtagctacagacgctggggaattttat
ggaagtgccgttctagtggctgccggagcgtggagtcgtcgttttttacctggtaaagaa
caggctttataccctgtaaagggagaagctctagcagttaaaacagaaaaaccgatcctt
catacaaccatttttacggatgattgctatctcgttccgaaaaaaggcggggaaataatt
gttggagcaacttctactccttatacatttgaccagcgggtaaccatggagggaatcgaa
ggattggttcataaagccaagaggcttctgcctttactggggaaagcagaaattgatcgg
atttgggctgggacgagacctatgactggagacggtctgccgattatgggagcgcaccca
gaattgaacagcttatattttagcacgggtcattatcgtaacgggatattattaagtcca
gttactgggaaggtaatggcagattatattgcaggggaaacgaagctcataacagattta
tcagctttttcacctgctcgctttcaaaaccatatggaggtgagttcattatga

DBGET integrated database retrieval system