KEGG   Halobacillus halophilus: HBHAL_3506Help
Entry
HBHAL_3506        CDS       T02031                                 

Definition
(GenBank) hypothetical protein
Organism
hhd  Halobacillus halophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqzE
Motif
Other DBs
NCBI-ProteinID: CCG45850
UniProt: I0JNY0
LinkDB All DBs
Position
complement(2471686..2471871)
Genome map
AA seq 61 aa AA seqDB search
MDRNDYVKFLTEEMVKYMQMSKQEKKQRKAAKPSKKSAFYWFGIIPLALRMIKKKHKTTE
Y
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atggaccggaatgattatgtaaagtttctcacggaagaaatggttaaatatatgcaaatg
agtaaacaggaaaagaagcagagaaaggcagcaaagccatcaaagaaaagcgctttttat
tggtttggtatcatccctcttgctcttaggatgattaaaaaaaagcataaaacgacggaa
tattga

DBGET integrated database retrieval system