KEGG   Halobacillus halophilus: HBHAL_3890Help
Entry
HBHAL_3890        CDS       T02031                                 

Gene name
sodC3
Definition
(GenBank) superoxide dismutase (Cu/Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hhd  Halobacillus halophilus
Brite
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HBHAL_3890 (sodC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CCG46232
UniProt: I0JQ12
LinkDB All DBs
Position
complement(2851738..2852313)
Genome map
AA seq 191 aa AA seqDB search
MYKWLWSVLAILIMLVGCSGEERSPLEISIYNSENDKIGTATFTERPEGVEVALKVEGVE
PGMHAVHIHEFPECEPPDFKSAGNHFNPMAKEHGLMNTNGAHTGDMANIEADGSGMIDVK
LTLSEAKLKEAQQSLLRKEGTSIVLSSGVDDGMSQPSGNSGERIACGEITLKADEDNTTD
PTEPDTKQEES
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaatggttatggtcagttcttgctatcttaattatgctggttggttgttctgga
gaagagagatcgccacttgaaatatctatctataatagtgaaaatgataaaattggtacc
gcgacttttacggaacgtccagaaggggtagaagtagcccttaaggttgaaggagtcgag
cctggcatgcatgcggttcatattcatgaattccctgagtgcgaacctcctgattttaag
agtgcaggcaaccattttaatccaatggctaaagaacatgggttaatgaatacgaatggt
gcccacacaggagacatggccaatatagaagcagatggaagtggaatgattgatgtaaaa
ctgactttaagtgaagctaaacttaaggaagcccagcaatctctgctaaggaaggaaggt
acatctattgtcctgagcagcggtgtagatgatggaatgtctcaaccgtctggtaattct
ggcgaacgtatcgcttgtggagagattacgttaaaagcagatgaagataatacaacggat
cctaccgagccagatacaaagcaagaagagagttaa

DBGET integrated database retrieval system