KEGG   Halobacillus halophilus: HBHAL_3926Help
Entry
HBHAL_3926        CDS       T02031                                 

Definition
(GenBank) UPF0721 family protein
  KO
K07090  uncharacterized protein
Organism
hhd  Halobacillus halophilus
Brite
KEGG Orthology (KO) [BR:hhd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    HBHAL_3926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: CCG46268
UniProt: I0JQ48
LinkDB All DBs
Position
complement(2880412..2881224)
Genome map
AA seq 270 aa AA seqDB search
MVILMFIIGLVTALVGSIAGLGGGVILVPVLLFLGDQLSAFDWVTPQSIVGISLVVMIFT
GMSSALSYLRHDRVDKKIGYVFLIGSVPGGIIGSWLNQFFKTDMFSLLFGCIMILVSLLF
FIPRKTPGTYLFNKGLKREKVIEGTTYTYQMPIVFGLILSLGVGMLSGLLGIGGGSLMVP
AMILLFNMPAHIATATSMFMIFFASISSSATHIFLGHVEWAYTLYFIPGAYLGGTLGARV
NRHLKGQAVEWFLRVLLILIGIRLIWQGIG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcctcatgtttataatcggtttagtgacagcattagttggaagcatcgctgga
ttaggtggcggtgttattttagtccctgttttactatttttgggagatcagctaagtgct
ttcgactgggtgactccgcagtcaattgttgggatttccctggtggtcatgatatttacg
ggaatgtcctctgctctttcatatttgagacatgaccgcgtagataaaaaaatcggatat
gtatttttaataggaagtgttcctgggggaattataggctcctggttaaatcaatttttt
aaaacggatatgttttctttattgttcgggtgtattatgattttagtttctttgctattt
tttataccgaggaaaactccaggtacttacttatttaataaaggcctcaaaagagagaag
gttattgaaggaacaacttatacgtatcagatgccgattgttttcggacttattctatcc
cttggagtgggaatgctgtcgggattgcttggcattggcggaggctctctaatggtgcct
gccatgattttattatttaatatgcccgcacacattgcaacggctacctcgatgttcatg
atcttctttgcgagcatctcaagctcggctactcacatctttctaggtcacgtcgaatgg
gcttatacactctactttattccaggggcatacttagggggaacgctcggagctcgtgtt
aaccggcatttaaaaggacaagctgttgagtggtttttaagagtattattaatcttaatc
ggtatccgtttaatatggcaaggaattggataa

DBGET integrated database retrieval system