KEGG   Helicobacter hepaticus: HH_1181Help
Entry
HH_1181           CDS       T00133                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxymyristoyl-(acyl carrier protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hhe  Helicobacter hepaticus
Pathway
hhe00061  Fatty acid biosynthesis
hhe00780  Biotin metabolism
hhe01100  Metabolic pathways
hhe01212  Fatty acid metabolism
Module
hhe_M00083  Fatty acid biosynthesis, elongation
hhe_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hhe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HH_1181 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HH_1181 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hhe01004]
    HH_1181 (fabZ)
Enzymes [BR:hhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HH_1181 (fabZ)
Lipid biosynthesis proteins [BR:hhe01004]
 Fatty acid synthase
  Component type
   HH_1181 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT Focal_AT
Motif
Other DBs
NCBI-ProteinID: AAP77778
UniProt: Q7U319
LinkDB All DBs
Position
1146482..1146991
Genome map
AA seq 169 aa AA seqDB search
MDTNKIQGDKPIMNVEKIRQILPHRYPMLLVDRVMELVQNTSDSEPNGYIKAYKNVTINE
EVFLGHFPNKPIYPGVMQIEGMAQAGGLLAFVSMFGDNVAEAKNKIVYFMTIDNVKFRIP
VVPGDRLVYELKVLKHKGSIWQLGANAFVEDKLVSEAELKAMITEAKES
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaataagatacaaggggataaacccataatgaatgtggagaaaattcgtcaa
attttaccacatcgttatccgatgttacttgttgatagagttatggagcttgtgcaaaat
acaagtgatagtgaaccaaatggttatatcaaagcatataaaaatgtaacaattaatgaa
gaggtatttttggggcattttccaaacaaacctatttatccgggtgtaatgcagattgaa
ggaatggcgcaagccggcggtcttttagcatttgtaagtatgtttggtgataatgttgca
gaggcaaaaaataaaattgtatattttatgacgatagataatgttaagtttcgtatccct
gtcgtcccaggtgataggcttgtatatgagctcaaggttttaaaacacaaaggaagtata
tggcaacttggagcaaatgcttttgttgaggataaacttgtaagtgaagctgaacttaaa
gctatgattactgaagctaaagaatcttaa

DBGET integrated database retrieval system