KEGG   Helicobacter hepaticus: HH_1203Help
Entry
HH_1203           CDS       T00133                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hhe  Helicobacter hepaticus
Pathway
hhe00620  Pyruvate metabolism
hhe00680  Methane metabolism
hhe01100  Metabolic pathways
hhe01120  Microbial metabolism in diverse environments
hhe01200  Carbon metabolism
Module
hhe_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HH_1203 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    HH_1203 (ppc)
Enzymes [BR:hhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HH_1203 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AAP77800
UniProt: Q7VGW7
LinkDB All DBs
Position
complement(1171131..1173830)
Genome map
AA seq 899 aa AA seqDB search
MQHSHSPQEGIKKSPKSTLLQPIQVEFVSDTIIHLLQSVDEELKNAFLNIKQSLQNHDST
MLKRILADISAQDKTLFIIKAFTLYHMLLNIIEELNLSNNAMLNHLPKTLKELNQEGYDK
NDTLEILQHLRFYPVFTAHPTESRRRTFLEAHHQMSENIKNIFAHNDANAKSQLLYRLHL
LWHTHLVRSEKMEILFELDNLLYIIESSILKSATQVLGDIKSTLGKALESSPIILGSWIG
GDRDGNPYVSNEVMTKTMKIAHKAIIEIYIRTSEKLIRELSMSMDFIQPSKRLIQSLQND
SSELLNNEAKLFAKEPFRAKLYLIKKKLQNRLIAINTTDSIDFTYKDSNELLEDIDMMIE
SLDDISARGLVEFRHLVLLGGFHLLRLDFREHRDIILSTISEIFCLIGFCDSDFKDLNEN
KKIEILNYALSAKKYDLNTIIEQLSESSKRLVGAFLRIQWAKKHISKHILQSFIISMSTQ
ASDLLCVLWFAKQSGLWKPGKKKEGKKGKASVSITPLFETIDDLQRAQSIIQTLYANTHY
QQYLFDHNSTQEIMVGYSDSSKDGGIFTSNYNLYCAISNLTKLQTQLDIRISFFHGRGGS
VSRGGGSLEEALLCSAPQSVHSFLKTTEQGEMISAKYLNSHIATKNFSSTLSALLKKGVY
DSYGTEKYKNNPQTMALLENVSNASCATYRALVYENKGFLEYFKNATPIKFIQNLNLGSR
PSKRKDTQKIEDLRAIPWVFAWTQNRAIISAWYGLGSGLANVDKNQLRDCYEQSLFFKTT
IDNISQALLKVDLDIASLYNQFVKDKKVREDIWEHIYTQYHLTMEYLLHLRGESVLLDSE
GAIRESILLRKPYLSVLNLTQIELIKKYESCKYPKGQERLLEQIHATIVGIAQGIRNTG
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgcaacactctcactcaccacaagaaggcataaaaaaatctccaaaatccactttgctc
caaccaatacaagtagaatttgtttctgatacaattattcacttgctccaaagtgttgat
gaggagctaaaaaatgcttttttaaatattaagcaaagtcttcaaaaccacgattcaact
atgcttaaacgcatacttgcagatatttcagcccaagataaaacactttttattattaaa
gctttcacgctttatcatatgttgcttaatattattgaagaacttaatttaagcaataat
gctatgcttaatcacctccctaaaactctaaaagagcttaatcaggaaggttatgacaaa
aatgatacactagagattttgcaacatttacgcttttatcccgttttcactgctcaccct
acagaatctcgccgccgcacatttcttgaagcacatcaccaaatgagtgaaaacatcaaa
aatatctttgcccataatgatgcaaatgctaaatctcagcttctctataggcttcattta
ttatggcacacacatttagtgcgaagtgaaaaaatggagattctctttgaacttgataac
ttactctatattattgaaagctctattcttaaatctgcaacgcaagtgctaggcgatata
aaatctacacttggcaaggcattagaaagctctcctatcatactaggaagttggataggt
ggtgatagagatggtaatccatatgtgagcaatgaagtaatgacaaaaacaatgaaaatt
gcacataaagcgattattgaaatctatattcgcacaagtgaaaagcttattcgtgagctt
tctatgtcaatggattttattcagcccagcaaacgccttatacaatcactccaaaatgat
agctccgaacttttaaataacgaagcaaaactttttgctaaagaacctttccgcgcaaaa
ctctacctcatcaaaaaaaagcttcaaaatcggcttattgcaattaatactaccgatagc
attgattttacttataaagattctaatgagcttttagaagatattgatatgatgatagaa
tctctagatgatatatctgcgcgtggattggtagaatttagacatttagtgctacttgga
ggttttcatcttttgcgccttgattttagagaacatagagatataattttaagcactata
agcgaaattttttgtcttatagggttttgtgatagtgattttaaagacttaaatgaaaac
aaaaagattgagattttaaactatgcgttaagtgctaaaaaatatgatttaaatacaatt
attgagcaactctctgaatcctctaagcggcttgtaggagcatttttaagaatccaatgg
gcaaaaaaacatatttcaaaacatattttacaaagctttattatctctatgagcactcaa
gcgagcgatttactctgcgtattgtggtttgctaaacaaagtggtttatggaaaccgggc
aagaaaaaagagggcaaaaaaggcaaagcgagtgtttctattacaccactttttgaaacc
attgatgatttacagcgcgcccaaagcattatccaaaccctctatgctaatactcattat
cagcaatatctttttgaccataatagcacccaagaaattatggtaggctattcagattca
agcaaagatggcggtatttttacgagcaattataatctctactgcgctattagcaatctt
accaaactccaaacgcaacttgatattcgcattagtttctttcacggacgaggaggaagc
gttagtcgtggtggaggaagccttgaagaagcgctactttgttctgcacctcaaagcgtg
catagctttcttaaaactacagagcaaggcgaaatgataagtgctaaatacctcaatagc
catattgcaaccaaaaacttttcaagcaccttgagtgctttgctcaaaaaaggagtatat
gattcttatggcacagaaaaatataaaaacaatccgcagacaatggcattgcttgaaaat
gtttctaatgcctcctgtgcaacttatcgcgcacttgtatatgaaaacaaaggcttttta
gagtattttaaaaacgctacacctataaaatttatacaaaaccttaatctaggctctcgc
ccaagcaaacgcaaagatacacaaaaaattgaagatttgcgggcaattccttgggtattt
gcttggacacaaaatcgcgctattatttccgcttggtatgggttaggaagtggattagca
aatgtagataaaaatcaattacgagattgttatgagcaatcactctttttcaaaacaact
attgataatatctctcaagctttgcttaaagtggatttagatattgcttcattatataac
caatttgtcaaagataaaaaagtgcgtgaggatatttgggagcatatttatacacaatat
catctcacaatggagtatttgctgcatttgcgtggggaaagtgtgcttttggattctgaa
ggtgctattagagaatctatcctattgcgcaagccttacctaagcgtgcttaacctcacc
caaattgaactgattaaaaaatatgaaagctgcaaatatcctaaaggacaagaacgtctt
cttgaacaaatccacgcgactattgtgggtatcgcacaaggtattcgcaatacagggtga

DBGET integrated database retrieval system