KEGG   Helicobacter hepaticus: HH_1332Help
Entry
HH_1332           CDS       T00133                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
hhe  Helicobacter hepaticus
Pathway
hhe00550  Peptidoglycan biosynthesis
hhe01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hhe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HH_1332
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HH_1332
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hhe01011]
    HH_1332
Enzymes [BR:hhe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HH_1332
Peptidoglycan biosynthesis and degradation proteins [BR:hhe01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   HH_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF4199
Motif
Other DBs
NCBI-ProteinID: AAP77929
UniProt: Q7VGI9
LinkDB All DBs
Position
1287998..1289785
Genome map
AA seq 595 aa AA seqDB search
MINLRYWLLIFFFIVVWFIIVIRLFVVNVINHEYYEKFAEKNITKTEVLVPMRGLIFDRN
TEPLAINEIGFSISLIPKIRNSRIVESEIERIISFLPSLDKEELFNLYKKNNHAYNHLPI
EIVNFVPYAQMLSIYAYLKRSSYVVIAPNSKRLYPNESAASHVIGYVSKANDKDIQNNPL
SQYSKVIGKEGIEKFYNSYLQGEAGYRKSHINSLHKEIKLLKEDSVLKRNDLYLSLDLKL
QESIDSEFTERSGAVIVMNVHNGEILAAGSYPEYNINWFVDGISYKNWEGLIENVHKPLI
NKLVYGRYPPGSVIKMGMVLAFLQYAGINESTLIQTPPFIEFGGRKFRDWKASGHGSADA
IKAIRESVDVYFYLLSQRAGIDNMASVLRQMGIGELTGVDIPNEVSGILPTPEWKLQRYG
EQWYKGDTITTSIGQGYFLSTPMQIARYTALIASGKLVTPHFAKEFNEESAEFEAKDILS
DFQKSKLDVLRKGMYQVCSVPGGTAYYRTQGTRVSLACKTGTAQVVGIPQDIQRRTREAD
MEYFHRSHAWITAFLPYENPQYAVTILIEHGGSGGSGGPVLVKIANKLKELGYIK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttgcgttattggttgcttattttcttttttatcgtagtgtggtttattatt
gtaatacgtctttttgtggtgaatgttattaatcacgagtattatgaaaaatttgctgag
aaaaatatcacaaaaactgaagtgcttgtgccaatgcgtgggttaatttttgatagaaat
accgaacctttggcaattaatgagatagggttttctatctcacttatacccaaaatacgt
aatagtcgtattgtcgaatctgaaattgaacgaatcatttcatttttgccctcacttgat
aaagaggaacttttcaatctctataaaaaaaataatcacgcctataaccacttgcctata
gaaattgtaaattttgttccttatgcccaaatgttgagtatttatgcctatcttaaacga
tcttcttatgttgttattgcacccaatagtaagcgtctatatccaaatgaaagtgcagcc
tcacacgttataggctatgtatcaaaggcaaatgataaagatatacaaaataatcctctt
tctcaatacagcaaggttattggcaaagaaggcattgagaaattttataattcgtattta
caaggcgaggcaggatatagaaaatctcatattaactctcttcacaaagaaatcaagctt
ttaaaagaagatagcgtgcttaaacgcaatgatttatatttatcgcttgatttaaagctc
caagaaagtattgattcagaatttacagaacgctctggagccgtaattgtgatgaatgtg
cataatggtgaaatacttgcagcagggagctatcctgaatataatattaattggtttgtt
gatggcattagctataaaaattgggagggacttattgaaaatgtccataagccacttatc
aataagcttgtgtatgggcgctatccacccggctctgttattaaaatgggtatggttttg
gcatttttacaatatgcaggaatcaatgaaagcactttgattcaaacaccgccttttata
gaatttggtgggcgaaagtttcgcgattggaaagcatcaggacacgggagtgctgatgca
atcaaagcaattagagaatctgtagatgtgtatttttatttgctttctcaacgtgcaggg
attgataatatggcaagtgtattgcgacaaatgggcataggtgagcttacaggcgttgat
attcccaatgaagtaagtggcatacttcctacgcctgaatggaaattgcaacgttatggt
gagcaatggtataagggggacacgattacaacttctattgggcaagggtattttctctct
acacctatgcaaatcgctcgttatacggcgcttattgcatcaggtaaattagtaacacca
cattttgcaaaagaatttaatgaagagagtgcagaatttgaggctaaagatatcctaagc
gattttcaaaaatctaaacttgatgttttgcgtaaaggtatgtatcaagtatgctctgtg
ccgggtgggacagcatattatcgcacgcaaggcacaagagtaagtcttgcgtgtaaaaca
gggacagcacaagtagtgggtattcctcaagatatacaaagacgaactagggaggcagat
atggaatattttcatcgttctcacgcttggattaccgcatttttaccctatgagaatcct
caatatgcagttacaattctcattgaacacggaggaagcggaggaagcggaggacctgtg
cttgtaaaaattgcaaacaagcttaaagaactaggctatattaaataa

DBGET integrated database retrieval system