KEGG   Herbaspirillum huttiense: E2K99_05180Help
Entry
E2K99_05180       CDS       T05937                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
hhf  Herbaspirillum huttiense
Brite
KEGG Orthology (KO) [BR:hhf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E2K99_05180
Enzymes [BR:hhf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     E2K99_05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N NADH_4Fe-4S ADH_zinc_N_2 CxC5
Motif
Other DBs
NCBI-ProteinID: QBP74441
UniProt: A0A4P7A6P4
LinkDB All DBs
Position
complement(1160932..1162020)
Genome map
AA seq 362 aa AA seqDB search
MHFHDDDMLAVVCHAPRDYRLQRVKRPAAGPNEVIIKIASCGICAGDCKCFAGAARFWGD
EVKNKPSYVKPPVIPGHEFWGHVVEMGPGAAEHHGVAMGDRVIAEQIVPCGKCRYCKTGY
RWMCEVHDVYGFQRQVAEGGMADYMRLSARAVIHKIPEHISFEDAAVTEPLSCAIHAVNR
GDIQLDDVVVIAGAGTLGLLMVQVAHLKTPKKLIVIDLSDQRLQLAREYGADIVINPGRE
DALKIVREATGQYGCDVYIETTGAPAGVTQGLDMIRKLGRFVEFSVFGRDTTVDWSIIGE
EKELDLRGAHLSGDCYPIAIDLLARGLVTSRGIVTHNYALSEWEAAIKMADSMDSIKVLL
KP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcatttccatgacgacgacatgctggccgtggtctgccacgcaccacgcgactatcgc
ctgcaacgggtcaagcggccggcggccggtcccaatgaggtcatcatcaagatcgcctcg
tgcggcatctgtgccggtgactgcaagtgcttcgccggtgccgcgcgcttctggggcgac
gaggtcaagaacaagccctcctatgtcaagccaccggtgattcccggccatgaattctgg
ggccatgtggtggagatgggaccgggcgcagccgagcaccacggcgtggccatgggcgac
cgggtgatcgccgaacagatcgtgccttgcggcaagtgccgctactgcaagaccggctat
cgctggatgtgcgaggtgcatgatgtctacggcttccagcgccaggtggccgagggcggc
atggctgactacatgcggctgtcggcgcgggcggtgatccacaagattcccgagcacatc
tcattcgaagatgccgccgtgaccgaaccgctgtcctgcgccatccatgccgtcaaccgc
ggcgacatccagctcgatgacgtggtggtgattgccggtgcgggcacgctgggcttgctg
atggtccaggtggcgcacctcaagacgccgaagaaactgatcgtcatcgacctctccgac
cagcgcctgcaactggcacgtgaatacggggccgatatcgtcatcaatccgggccgcgag
gatgcgctgaagatcgtgcgcgaagccactggccaatatggctgtgatgtctacatcgag
accaccggcgcgcccgccggcgtgacgcaaggactggacatgatccgcaagctgggccgc
ttcgtggagttcagcgtctttggccgtgacactaccgtggactggtccatcatcggtgaa
gaaaaggaactggacttgcgcggcgcgcacctcagcggagactgctatcccatcgccatc
gacctgctggcgcgcggcctggtgacctcacgcggcatcgtgacgcacaactatgccctt
tctgaatgggaagccgccatcaagatggccgactcgatggattcgatcaaggtactgctc
aagccctaa

DBGET integrated database retrieval system