KEGG   Herbaspirillum huttiense: E2K99_22230Help
Entry
E2K99_22230       CDS       T05937                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hhf  Herbaspirillum huttiense
Brite
KEGG Orthology (KO) [BR:hhf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E2K99_22230 (ahpF)
Enzymes [BR:hhf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E2K99_22230 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 FAD_binding_3 NAD_binding_7 Glutaredoxin HI0933_like NAD_binding_8 Thi4 FMO-like DAO AlaDh_PNT_C K_oxygenase
Motif
Other DBs
NCBI-ProteinID: QBP77540
UniProt: A0A4P7AD42
LinkDB All DBs
Position
complement(4973093..4974694)
Genome map
AA seq 533 aa AA seqDB search
MLDANLKTQLKAYLEKVSHPIEIVASLDDGAKSREMQELLQDIVLLSDRIKLVEQRGADA
QGRTPSFRLNRPGTPISVEFAAIPMGHEFTSLVLALLQVGGHPVKLDDKVIEQIKNLDGD
YRFETYVSLTCQNCPEVVQALNVMSIINPRIQSVTIDGALFQGEVEQRQIMAVPTVYMNG
EVFGQGRTGVEEILAKLDTGAAARKGEELSAKEPYDVLIVGGGPAGAAAAIYAARKGIRT
GVVAERFGGQVLDTLAIENFISVQETEGPQFATALEQHVRAYDVDIMNVQRAEALVPGDK
LIEVKLANGGVLKGKTVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVSVI
GGGNSGVEAAIDLAGIVAHVTLIEFAAELKADAVLVRKLKSLPNVTIVTSAQTTEITGDG
QRVNGISYKERETGEVKHVELEGVFVQIGLVPNTEWLKGTLALSKHGEIEIDAKGQTSIP
GVFAAGDVTTVPYKQIVIAVGAGATAGLSAFDHLIRSSADDVAPAVAKEAVAA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatctcaagacccaattgaaggcctatctggaaaaggtcagccacccg
atcgagatcgtcgcgtcgctcgatgatggcgccaagtcccgtgagatgcaggaactcctg
caagacatcgtgctgctgtcggaccgcatcaagctggtcgagcaacgcggtgccgatgcc
cagggacgtaccccgtccttcagactgaaccgccccgggacccctatcagcgtcgaattc
gccgcgatcccgatgggccacgaattcacctccctggtgctggcgctgctgcaagtcggc
gggcacccggtcaagctcgacgacaaggtcatcgagcagatcaagaacctggacggcgat
tatcgcttcgagacctatgtctcgctgacttgccagaactgcccggaagtcgtgcaggcg
ctgaacgtgatgtccatcatcaatccgcgcatccagtcggtgaccatcgacggcgcgctg
ttccagggtgaagtcgagcaacgccagatcatggccgtgccgaccgtctacatgaacggt
gaagtcttcggtcagggccgtaccggcgtggaagagatcctcgccaagctcgacaccggt
gccgctgcccgcaagggtgaagaactgagcgccaaggagccgtatgacgtgctcatcgtc
ggcggtggccccgctggtgcagctgctgcgatctatgcagcgcgcaagggtatccgtacc
ggcgtggtggccgagcgtttcggcggccaggtgctcgacaccctggccatcgagaacttc
atctcggtgcaggagaccgaaggcccgcaattcgccactgcgctggaacagcacgtgcgg
gcctatgacgtcgacatcatgaacgtgcagcgcgctgaagcgctggtgccgggcgacaag
ctgatcgaagtgaagctggccaatggcggcgtgctgaagggcaagaccgtgatcctgtcc
accggtgcccgctggcgcaacgtcaacgtgccgggcgagcaggaatacaagaacaagggc
gtggcctattgcccgcactgcgatggtccgctgttcaagggcaagcgcgtgtcggtgatc
ggtggcggcaactcgggcgtggaagcagccatcgacctggccggcatcgtcgcccatgtg
accctgatcgagttcgcagccgaactgaaggccgatgcggtgctggtgcgcaagctcaag
agcctgcccaatgtgaccatcgtgacgtcggcgcagacgaccgagatcaccggcgacggc
cagcgcgtcaacggtatcagctacaaggaacgcgaaaccggcgaggtcaagcacgtggaa
ctggaaggcgtgttcgtccagatcggcctggtgcccaacaccgaatggctcaagggaacc
ctggccttgtccaagcacggcgagatcgagatcgacgccaagggccagacctcgattccg
ggcgtcttcgcggccggtgacgtcaccacggtgccgtacaagcagatcgtcatcgccgtg
ggtgcaggtgcaacggctggcctgtcggccttcgatcacctgatccggtcgtcggcggat
gatgtggcaccggcagtagccaaggaagcggttgcggcctga

DBGET integrated database retrieval system