KEGG   Halomicronema hongdechloris: XM38_000120Help
Entry
XM38_000120       CDS       T04928                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00500  Starch and sucrose metabolism
hhg01100  Metabolic pathways
hhg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XM38_000120
Enzymes [BR:hhg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     XM38_000120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ASC69086
UniProt: A0A1Z3HFN0
LinkDB All DBs
Position
complement(15066..17861)
Genome map
AA seq 931 aa AA seqDB search
MYAKPVGDESGLEPPIKAEDPKRVLREAGKVKTRGQNAPSWNTGISVTMQPICTFNVTPS
LPPRLEALRILAYNLRWDWDSDTNDLFRRLDPDLWQSSRYNPVLMLGTIRQSRLQEVAED
EGFLAQMDRAVQRLQDYQQKRTWYRKHRSEGKAGECYAYFSMEFGLTSCMPVYSGGLGVL
AGDHLKSASDLGLPLVAVGLLYQEGYFAQYLNADGWQQERYPINDFYNMPLHLERTADGS
ELRISVDYPGRTVYARVWRVQIGRVPLYLLDTNIEPNNQYDQDICDRLYGGDIDVRIHQE
IMLGIGGVRMLKALGLAPTVYHMNEGHSAFLVLERIKNLMDEAGISYAEALQVAQASQMF
TTHTPVPAGIDLFPPDKVLYYLGHYGHRFGLANDEFLALGREDTGDLSAPFSMAVLAIKL
ATSVNGVSELHAEVSRKMFCGLWNGLPLSEVPIHAITNGVHARSCVAKSTQELYDRYLGP
NWSQAGSHDPLWERVNSIPDEELWRNHELCRSQLVVYVRDKLQQGLRERGAAAHEFLEAQ
EVLDPFVLTIGFARRFATYKRATLFLRDVERIRRIIKGQGEGRRVQFVIAGKAHPRDIPG
KELIRKIIHFTHDEELSRSIVFVPNYDIHLARAMVAGCDVWLNNPRRPREASGTSGMKAA
MNGLPNLSVLDGWWAEADYIRTGWPIGSGEDYDDPDYQDDVEANALYELLEQEVVPLFYD
RDNDELPRGWVAKMKDAIRLNTPQFNTARMVKEYAERCYFAASDNSMTLAAQSYTPAKAL
ATWQAHLIEHWYAMKIESVTVSEPSDLTVNQVLQVQAQIDLGALTPDDVQVQLYQGKVEI
DGEMHSGRATPMTYQGQDQQGRCQYKIDVSYEASGLQGLSLRILPEHKYLNSPYDLRLVM
WAEPDTVAINVNNQGQDPKPSSVAESMAVAP
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgtacgctaagcccgtcggggacgaaagtggcttagagccacctatcaaggctgaagat
cccaaaagagtattaagagaggcggggaaggtgaagacaagggggcagaatgctcctagc
tggaacacagggatctctgtcaccatgcaacccatctgcacattcaatgtgacaccgtca
ctgccccctagattggaggcactgcgtatactcgcctataacctccgctgggattgggac
tctgataccaatgacctatttcgccgcttagatccagacctatggcagtccagtcgttac
aacccagtcttgatgttgggcaccattcggcagtctcgcctgcaagaagttgctgaagac
gaaggattcttggcccaaatggatcgggcagtccagcggttgcaggattatcagcagaag
cggacttggtaccgcaagcatcgatctgagggcaaggccggggagtgctacgcctatttt
tccatggagtttggcctcacctcttgcatgccagtctattctggcggcctaggcgtgttg
gctggtgatcacttgaaatctgccagtgatttgggactgcccttggtggctgttggcctg
ctttatcaggaagggtattttgcccagtacctcaatgccgatggctggcagcaggaacgc
tacccgattaatgatttctacaacatgccgctgcatctggaacgcacggcagatgggtca
gagcttagaatctcggtcgattacccagggcgtactgtctatgctcgggtgtggcgggtg
cagattggtcgggtacctctttacctactagatacaaatattgagcctaacaatcaatac
gatcaggatatttgcgatcgcttgtatggcggtgacattgatgttcgcattcaccaggaa
atcatgctggggattggcggcgtgcggatgctgaaggctctgggattggcgcccacggtg
taccacatgaatgagggccactctgcgtttttggtgctggagcggattaaaaacctcatg
gatgaggctggcattagctatgccgaggccttacaggtggcccaagccagccagatgttt
accacccataccccagtcccggccgggattgacctatttcccccggataaggtgctctat
tatctaggtcactacgggcatcgatttggcttggccaacgacgaatttttagccctaggt
cgcgaagatacgggagacttgagtgcccccttcagtatggctgtgctggctatcaaactg
gcaacctcggtcaatggtgtcagtgagctccatgccgaggtatcccgcaagatgttctgt
ggactatggaacggacttcccctgagtgaggtaccgattcatgccatcactaatggggtc
catgcccgcagttgtgtggccaagtctacccaagagttgtatgaccgctatttgggtccc
aactggtcccaagccggtagccatgatcctctctgggagcgagtcaactcgattccggac
gaagaactgtggcgtaatcacgagctttgccgctcgcagctggtcgtctatgtgcgggat
aagctgcaacaaggcctgcgggaacgaggagcggctgcccatgagtttctagaagctcag
gaggtcctcgatccatttgtcttgaccattggctttgcccgtcgatttgcgacttataag
cgggcgacgctatttttgcgggacgtcgagcgtattcgccgcatcatcaaaggccaagga
gaggggcgccgggtgcaattcgtgattgcgggtaaagctcatcccagagatattcctggc
aaggagttgatccgcaaaatcattcactttacccatgatgaagaactcagccgctccatt
gtcttcgtgcctaactacgatatccatttggctcgggcgatggtggcgggttgtgatgtc
tggctcaataacccgcggcgacctcgggaggcctccggtaccagtgggatgaaagcggcc
atgaatggcttgcccaacctcagtgtgttggatggttggtgggctgaggctgactatatt
cgcacggggtggcccattggatctggggaagattacgacgacccagattaccaggatgat
gtggaagcgaatgcgctctacgaattattagagcaggaagtagtccccctcttctatgac
cgggataacgatgagcttcccagaggatgggtggccaaaatgaaggatgctattcgcctg
aacacccctcaatttaatacggcccgcatggttaaagagtatgccgagcgttgctacttt
gcagccagtgacaatagcatgacgttggctgcccagagttatactcctgcgaaggcatta
gcgacttggcaagctcacctgatagagcattggtatgccatgaagattgagtcggtcacg
gtgtcggaaccgtctgatctcacagtcaatcaggtcctacaggttcaggctcagattgac
ctaggagccctgacgccggacgatgtgcaggtacagctttaccagggcaaagtcgagatt
gatggggagatgcacagtggtcgagctacgccaatgacctatcaaggacaggaccaacag
gggcgctgtcaatacaagatcgatgtgtcttacgaagccagtggtttacaggggctctcg
ttgcgaattctacctgagcacaaatatctcaatagtccctatgacctgagattggtgatg
tgggctgagcccgatactgttgccattaatgttaacaatcagggccaagacccgaaacct
tcttccgtagcagagtctatggccgttgctccttag

DBGET integrated database retrieval system