KEGG   Halomicronema hongdechloris: XM38_003520Help
Entry
XM38_003520       CDS       T04928                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00620  Pyruvate metabolism
hhg00680  Methane metabolism
hhg00710  Carbon fixation in photosynthetic organisms
hhg01100  Metabolic pathways
hhg01120  Microbial metabolism in diverse environments
hhg01200  Carbon metabolism
Module
hhg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:hhg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XM38_003520 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    XM38_003520 (ppc)
   00680 Methane metabolism
    XM38_003520 (ppc)
Enzymes [BR:hhg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XM38_003520 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ASC69425
UniProt: A0A1Z3HGN9
LinkDB All DBs
Position
379876..382998
Genome map
AA seq 1040 aa AA seqDB search
MSSTLHPSDDKFSAGSTAVDTLMEKVAPASSAHDLLFRHRLRVVEEIWEGVLRQECGQNL
VDLLQKLRLMCSPEGQAPTAREASVVNVVHVVEQLDLEDAIQASRAFALYFQLINIVEQH
YEQQGQQRQYRAAYDKVGPSAHAANSAYETHPSAEHRPGLPVSDVEEGSNGHRFQASLLA
RSLMTRRDNQRDIGTFHWLFPSLKQLNVPPRLIQTLVDQLDVRLVFTAHPTEIVRHTIRD
KQRRISDILRELDRAEESTQGSGLSSSWDLEELKSRLTEEVRLWWRTDELHQFKPSVLDE
VDYTLHYFQVVLFDTLPQLYYRFKRALNITFPHLTPPKPNFCRFGSWVGADRDGNPSVTP
DITWRTASFQRNLVLNKYIASIEHLTQLLSLSLHWSEVMPELLESLEQDQAQMPKVYDRL
AIRYRQEPYRLKLAYIQQRLENTLKRSLSLFQGDPRPEKVTELAPGTFYRTGPDFLAELQ
MIQRNLEATGLVCQDLETLICQVEIYGFNLAQLDIRQESSRHSDALNEITEYLQILPTAY
GHLSEAEKTAWLTAELQTRRPLVPGELPFSDKTRETIETFRMVRHLHQEFGPDICRSYVV
SMSHHVSDMLEVLLLAKEAGLYDPATHRSAIQPVPLFETVEDLQRAPAVMNQLFELPLYR
TALQGGIEPAQSEDMPLQEVMLGYSDSNKDSGFLSSNWEIHKAQQSLQSTADGYGIALRI
FHGRGGSVGRGGGPAYEAILAQPGRSINGRIKITEQGEVLASKYNLPDLALYNLETVTTA
VIQASLLNSSFDHIQPWNEIMEELADRSRCHYRELIYEQPDLVDFFHHVTPIEEISQLQI
SSRPARRGGKKDLGSLRAIPWVFSWTQARFLLPSWYGVGTALNEFLQQQPTEHLKLLRYF
YYKWPFFKMVISKVEMTLAKVDLQIAEHYLRELTPGEKHERFQVLFDKISQEFHLTCEMV
LKITGNQRLLDSDPELQRSVYLRNGTIVPLGFLQVSLLKRLRQHKNATAGVIRSRYSRGE
LLRGALLTINGIAAGMRNTG
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgagttctaccctgcatccctccgacgataaattttcggctggttctacagcagtagat
accctaatggagaaagtggctccagcttcctcagcccacgatctattgtttagacatcgt
ctcagagtcgtcgaggagatctgggaaggtgttctacggcaagagtgcggacaaaaccta
gtcgatctgctgcaaaagttgcggttaatgtgctcccccgaggggcaagccccgacggcc
cgagaagccagcgttgtcaatgttgttcatgtcgtcgagcaactcgatctcgaagatgcc
attcaagcctctcgagccttcgccctctactttcaactgatcaacatcgtcgagcagcat
tacgagcaacagggacagcagcgtcaatatcgggcggcctacgataaggtaggcccgagc
gctcacgctgctaattccgcctatgagactcacccatcggccgagcatcgacctgggctg
ccggtatctgatgtggaagaaggcagtaacggccatcgcttccaggctagcttactggct
cgcagcttgatgacccggcgagacaaccagcgggacattggcaccttccactggttattc
ccctccctgaaacagctcaatgttcccccacgcctgattcaaaccctggtcgatcaatta
gacgttcgcctggtcttcacggcccaccccactgaaattgtgcgccacaccatccgtgac
aagcaacggcgcatttctgacatcttgcgggagcttgatcgggccgaggagagtacccaa
ggcagcggactgtcctccagttgggacttggaagaattgaagagccgactcacagaagag
gttcgactctggtggcgtaccgatgagctccatcagtttaagccctctgtcttagatgaa
gtcgactataccctgcactatttccaggtggtcctattcgacacgctgccgcagctctat
taccgctttaagcgggcccttaatatcaccttccctcacctaacgcctcccaagcccaac
ttttgtcgctttggctcttgggtcggggccgaccgagacggtaatccctccgtgacccca
gatattacctggcgcacggcctcgtttcagcgcaacctggtcctgaacaaatacattgcc
tccattgagcatctgactcaactgctcagcctgtccctgcactggagcgaggtgatgcca
gagctgctggagtccctggagcaagaccaggcccagatgcccaaagtctatgaccgcctg
gccattcgctatcgtcaggagccctatcggctgaagctggcctacatccaacagcggcta
gaaaacaccctgaaacgcagcctcagcctatttcagggggatcctcgccctgagaaggtg
acggagttagcccctggcaccttctatcgcaccggtcccgactttctggctgagttgcag
atgattcagcgcaacctagaggcaactggtctagtatgtcaggacctggaaaccttaatt
tgccaggtggaaatctatggcttcaacctggctcagctcgacatccgccaggaaagctct
cgccattccgatgccctcaacgaaatcaccgagtatctgcagattctgcccaccgcctat
ggccacctgagtgaagccgaaaaaacggcttggctcaccgcagaactgcagactcgtcgt
cccttggtgcctggtgaactgccgttttctgacaagactcgggaaaccatagagaccttt
cgcatggtgcggcacctacaccaggaatttggccccgacatctgccgcagctacgtggtc
agcatgagtcatcatgtcagtgacatgctggaggtgttgctgctggccaaggaagctggt
ctctacgatcccgccacccatcgctcggcgattcaaccggtgcctctgttcgaaaccgtg
gaggacttacaacgggcaccggcggtgatgaatcaactgtttgaattgcccctgtatcgg
acggccctgcaggggggaatagaaccggcccagtctgaagacatgccgttgcaggaagtg
atgctgggctattctgacagcaacaaagattcgggattcctcagcagtaattgggagatc
cataaggcccagcagtctttacaatccacggccgatggctatggcattgccctgcggatt
ttccatggccgcggcggctctgtcgggcgagggggcggcccggcctatgaagcgattctg
gcccagcccggccgcagtattaatggccgcatcaagatcacggagcaaggggaagtgctg
gcctctaagtacaatctgccggatctggccttatataacctagagaccgtgaccacggct
gtaatccaagctagcttactcaacagtagtttcgatcacatccagccttggaatgaaatc
atggaggagttggcggatcggtctcgctgccactatcgtgagttgatttacgagcaacca
gatttggtggattttttccaccatgtgacacccatcgaagaaatcagccaactgcagatc
agttcccgtccggcccggcgcggtggcaagaaagatttgggcagtctgcgggcaattccc
tgggtcttcagctggactcaggctcggtttctactgccctcttggtatggggtgggcacg
gccctgaatgaatttctacaacagcagcccaccgagcatctgaaactgctgcggtacttc
tactacaagtggcccttcttcaagatggtgatttcgaaggtagaaatgactctggccaag
gtggatttgcaaattgctgagcattatttgcgagaactcacgcctggggaaaagcatgag
cgcttccaggtcttgtttgacaagatctcccaggaatttcatctcacttgtgagatggtc
ctcaaaatcactggaaatcagcggctgctagacagtgatccggagttgcagcgctcggtg
tatttgcgcaatggcaccatcgtgcccctgggctttctgcaggtatccctgctgaagcgg
ctgcgccagcataagaacgccaccgctggtgtgattcgctctcgctatagtcggggagaa
ttgttgcgaggagcgttgctgacgatcaacggtatcgcggcaggcatgcgcaataccggc
tag

DBGET integrated database retrieval system