KEGG   Halomicronema hongdechloris: XM38_005460Help
Entry
XM38_005460       CDS       T04928                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00010  Glycolysis / Gluconeogenesis
hhg00020  Citrate cycle (TCA cycle)
hhg00620  Pyruvate metabolism
hhg01100  Metabolic pathways
hhg01110  Biosynthesis of secondary metabolites
hhg01120  Microbial metabolism in diverse environments
hhg01130  Biosynthesis of antibiotics
hhg01200  Carbon metabolism
Module
hhg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XM38_005460 (pdhC)
   00020 Citrate cycle (TCA cycle)
    XM38_005460 (pdhC)
   00620 Pyruvate metabolism
    XM38_005460 (pdhC)
Enzymes [BR:hhg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XM38_005460 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ASC69618
UniProt: A0A1Z3HH91
LinkDB All DBs
Position
557402..558712
Genome map
AA seq 436 aa AA seqDB search
MIREIFMPALSSTMTEGKIVAWEKSPGDWVDKGETVVIVESDKADMDVEAFYEGYLATVI
AEAGDTVPVGNAIALLAETEAEIDTAKQQASAQASAGASDSATTATAPAKTAPAPEPIPS
EPADNNGATGTSTTGTASGRLIVSPRARKLAKDLKVDLSTIQGSGPHGRIVAQDVERAAG
KVPTSPGPDTIPTPAAAPAPAAPAAPTPAPAVAGQVVPMNTLQQAVVRGMVASLSAPTFH
VGYTITTDAMDALYKQIKGKGVTMTALLAKAVAVTLQKHPLLNACYADQAIQYFGQIHVA
VAVAMDDGGLITPVLQRADQLDIYSLSRAWKDLVARARSKQLQPEEYNSGTFTLSNLGMF
GVDRFDAILPPGQGAILAIGASQPTVVANDDGMLGVKRQMQVNITCDHRVIYGAHAAAFL
QDLAQLIETNPQSLTL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagaaattttcatgcccgccctcagttccaccatgaccgaaggcaagattgtc
gcttgggaaaagtcccctggggattgggtggacaaaggtgaaaccgtcgtcatcgtcgag
tccgataaggcagacatggatgtggaagccttctatgagggctacctagctactgtgata
gcagaggcgggggatacggtgccggtgggtaatgcgatcgcactgttagccgaaaccgag
gccgagatcgacaccgccaagcagcaggccagcgcccaagccagcgccggtgccagtgac
agtgccactacggcgacggcccccgctaagacagctcctgctccggaaccgatcccgtca
gaaccggcggacaacaatggagccactggcaccagcactacagggacagccagtggccgc
ctgatcgtctccccccgggcccgcaagttggccaaagatctgaaagtggatctcagcacc
atccagggcagcgggccccatggccgcatcgtggcccaagatgtagagcgggccgctggc
aaagtccccacttcccccgggccagacaccatccccaccccggcagctgcccccgcccca
gccgccccggcagccccgacgccagcgccggcagtggctggtcaggtggtgccgatgaat
accctgcagcaagccgtcgtccggggcatggtggccagtctatcggcgcccaccttccat
gtgggctacaccatcaccaccgacgccatggatgccctctataaacagatcaagggcaag
ggggtgacgatgactgccctgttggccaaggcagtggccgtgaccctgcaaaagcacccg
ctactcaacgcctgctacgccgaccaggccattcaatatttcggtcagatccatgtggcg
gtggcggtggccatggacgatggcggcttgattacaccggtgttgcagcgagccgaccag
ctcgatatctattccctgtcgcgcgcttggaaggatctggtagcccgagcccgcagcaag
cagctgcagccagaagagtacaactctggcaccttcaccctgtctaacttgggtatgttt
ggggtagatcgcttcgatgcgattttgccgccaggccagggggcaattttggccattggg
gcttcccagcccacggtagtggccaacgacgacggcatgttgggggtgaagcggcagatg
caagtcaatatcacctgtgaccaccgggtgatctatggcgcccacgccgccgccttcttg
caggatttggcccagctgatcgaaaccaatccccagtcattgaccctctag

DBGET integrated database retrieval system