KEGG   Halomicronema hongdechloris: XM38_005460
Entry
XM38_005460       CDS       T04928                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00010  Glycolysis / Gluconeogenesis
hhg00020  Citrate cycle (TCA cycle)
hhg00620  Pyruvate metabolism
hhg01100  Metabolic pathways
hhg01110  Biosynthesis of secondary metabolites
hhg01120  Microbial metabolism in diverse environments
hhg01200  Carbon metabolism
Module
hhg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XM38_005460 (pdhC)
   00020 Citrate cycle (TCA cycle)
    XM38_005460 (pdhC)
   00620 Pyruvate metabolism
    XM38_005460 (pdhC)
Enzymes [BR:hhg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XM38_005460 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: ASC69618
UniProt: A0A1Z3HH91
LinkDB
Position
557402..558712
AA seq 436 aa
MIREIFMPALSSTMTEGKIVAWEKSPGDWVDKGETVVIVESDKADMDVEAFYEGYLATVI
AEAGDTVPVGNAIALLAETEAEIDTAKQQASAQASAGASDSATTATAPAKTAPAPEPIPS
EPADNNGATGTSTTGTASGRLIVSPRARKLAKDLKVDLSTIQGSGPHGRIVAQDVERAAG
KVPTSPGPDTIPTPAAAPAPAAPAAPTPAPAVAGQVVPMNTLQQAVVRGMVASLSAPTFH
VGYTITTDAMDALYKQIKGKGVTMTALLAKAVAVTLQKHPLLNACYADQAIQYFGQIHVA
VAVAMDDGGLITPVLQRADQLDIYSLSRAWKDLVARARSKQLQPEEYNSGTFTLSNLGMF
GVDRFDAILPPGQGAILAIGASQPTVVANDDGMLGVKRQMQVNITCDHRVIYGAHAAAFL
QDLAQLIETNPQSLTL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgattcgagaaattttcatgcccgccctcagttccaccatgaccgaaggcaagattgtc
gcttgggaaaagtcccctggggattgggtggacaaaggtgaaaccgtcgtcatcgtcgag
tccgataaggcagacatggatgtggaagccttctatgagggctacctagctactgtgata
gcagaggcgggggatacggtgccggtgggtaatgcgatcgcactgttagccgaaaccgag
gccgagatcgacaccgccaagcagcaggccagcgcccaagccagcgccggtgccagtgac
agtgccactacggcgacggcccccgctaagacagctcctgctccggaaccgatcccgtca
gaaccggcggacaacaatggagccactggcaccagcactacagggacagccagtggccgc
ctgatcgtctccccccgggcccgcaagttggccaaagatctgaaagtggatctcagcacc
atccagggcagcgggccccatggccgcatcgtggcccaagatgtagagcgggccgctggc
aaagtccccacttcccccgggccagacaccatccccaccccggcagctgcccccgcccca
gccgccccggcagccccgacgccagcgccggcagtggctggtcaggtggtgccgatgaat
accctgcagcaagccgtcgtccggggcatggtggccagtctatcggcgcccaccttccat
gtgggctacaccatcaccaccgacgccatggatgccctctataaacagatcaagggcaag
ggggtgacgatgactgccctgttggccaaggcagtggccgtgaccctgcaaaagcacccg
ctactcaacgcctgctacgccgaccaggccattcaatatttcggtcagatccatgtggcg
gtggcggtggccatggacgatggcggcttgattacaccggtgttgcagcgagccgaccag
ctcgatatctattccctgtcgcgcgcttggaaggatctggtagcccgagcccgcagcaag
cagctgcagccagaagagtacaactctggcaccttcaccctgtctaacttgggtatgttt
ggggtagatcgcttcgatgcgattttgccgccaggccagggggcaattttggccattggg
gcttcccagcccacggtagtggccaacgacgacggcatgttgggggtgaagcggcagatg
caagtcaatatcacctgtgaccaccgggtgatctatggcgcccacgccgccgccttcttg
caggatttggcccagctgatcgaaaccaatccccagtcattgaccctctag

DBGET integrated database retrieval system