KEGG   Halomicronema hongdechloris: XM38_011320Help
Entry
XM38_011320       CDS       T04928                                 

Gene name
rbcL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00630  Glyoxylate and dicarboxylate metabolism
hhg00710  Carbon fixation in photosynthetic organisms
hhg01100  Metabolic pathways
hhg01120  Microbial metabolism in diverse environments
hhg01200  Carbon metabolism
Module
hhg_M00165  Reductive pentose phosphate cycle (Calvin cycle)
hhg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
hhg_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:hhg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XM38_011320 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    XM38_011320 (rbcL)
Enzymes [BR:hhg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     XM38_011320 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ASC70202
UniProt: A0A1Z3HIQ5
LinkDB All DBs
Position
1178324..1179754
Genome map
AA seq 476 aa AA seqDB search
MSYSQTSTQSKAGYKAGVQDYKLTYYTPDYTPKDTDILAAFRMSPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYIAYVAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRALRLEDLRIPVAYLKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRACYECLRGGLDFTKDDENINSQPFMRWRDRFLFVADAIHKAQAETGEIKGHY
LNCTAPTCEEMLKRAQFAKDLEMPIVMHDYLTAGFTANTTLARWCRDNGLLLHIHRAMHA
VIDRQRNHGMHFRVLAKCLRMSGGDHIHTGTVVGKLEGDRESTLGFIDLLRENYVEEDKS
RGVYFTQDWASMGGVFAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRNLAREGSDIIKEAAKWSPELAAACELWKEIKFEFETMDKL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactctcagacatcgactcagtcaaaagctggatataaagccggggtacaggac
tacaagctgacctactacaccccggattacaccccgaaagataccgacattctggccgcc
tttagaatgtctccccagcctggggtgcctccagaggaagctggagccgccgttgcagca
gaatcctccacggggacctggacgacggtgtggaccgacctgctaaccgacctggatcgc
tataagggtcggtgctatgacatcgagcctgtccctggcgaagacaatcaatacatcgcc
tacgtcgcctatcctttggatctcttcgaggaaggctctgtgaccaacatgctcacctcg
atcgtaggcaatgtgtttgggttcaaggctctgcgagccctgcgtctagaagacctgaga
atacccgttgcttacctcaagaccttccagggtcccccccatggcatcaccgtggagcgg
gacaagctaaataagtacggtcgtcccttgctgggttgcaccattaagcccaagctgggg
ctgtcggctaagaactatggtcgagcctgctatgaatgcctgcgcggtggtctagacttc
accaaagacgacgaaaacattaattctcagccgtttatgcgctggcgcgatcgctttttg
ttcgtggcggatgctatccacaaggcccaggctgaaaccggtgaaattaaagggcactat
ctcaactgcaccgctcctacctgcgaagaaatgttgaagcgggctcagttcgccaaagac
ctggaaatgcccattgtcatgcacgactacctgaccgctggctttacagctaacactacc
ctggctagatggtgccgcgacaacggcctgctgttgcacattcaccgagccatgcacgcc
gtcatcgatcgccagcgtaaccatggcatgcatttccgggtcttggctaagtgtttgcgc
atgtccggtggcgaccacatccacaccggtaccgtggtcggcaagctggaaggtgatcgg
gagagcaccctgggattcatcgacctgctgcgggaaaactacgtcgaagaagataagtcc
cgcggggtctacttcacccaagattgggcctccatgggtggtgtctttgcggtggcctcc
ggcggtattcacgtgtggcacatgccggctctggtggaaatcttcggcgatgattccgta
ctgcagttcggtggtggtaccctgggacacccctggggcaatgcgcctggagcaacggcc
aaccgagttgccctggaagcctgtgtgcaggcccgtaacgaaggtcgtaacctggcccgt
gaaggctctgacatcattaaggaagctgccaagtggtctcctgagctggcagcggcctgc
gaactgtggaaggaaatcaagttcgaatttgagaccatggataagctctaa

DBGET integrated database retrieval system