KEGG   Halomicronema hongdechloris: XM38_011340Help
Entry
XM38_011340       CDS       T04928                                 

Gene name
rbcS
Definition
(GenBank) Ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
hhg  Halomicronema hongdechloris
Pathway
hhg00630  Glyoxylate and dicarboxylate metabolism
hhg00710  Carbon fixation in photosynthetic organisms
hhg01100  Metabolic pathways
hhg01120  Microbial metabolism in diverse environments
hhg01200  Carbon metabolism
Module
hhg_M00165  Reductive pentose phosphate cycle (Calvin cycle)
hhg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
hhg_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:hhg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XM38_011340 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    XM38_011340 (rbcS)
Enzymes [BR:hhg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     XM38_011340 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ASC70204
UniProt: A0A1Z3HIQ8
LinkDB All DBs
Position
1180453..1180794
Genome map
AA seq 113 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDAQIERQIDYILQMGYIPAIEFNETSDPEVYYWTMWKLPL
FNASTPQEVLSEVQACRSEYSNCFIRVVGFDNVKQCQILSFIVHKPGASTYRY
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctgcccaaagagcgtcgttacgagaccctatcttatctgccccccttaacg
gatgcccagattgagcggcagattgattacatcttgcagatgggttatattcctgcgatt
gagttcaatgaaacctcggatcctgaggtttactactggaccatgtggaagctgcctcta
tttaatgcctctacgccccaggaagtcctgagtgaggtgcaggcgtgtcgttctgagtac
tccaactgtttcatccgagtggtgggctttgacaatgtgaagcaatgccaaattcttagc
ttcatcgtccacaagccgggtgccagcacctatcgctactaa

DBGET integrated database retrieval system